HOG Organism Gene ID Name Annotation
aHOG1303 hhi 2101 HAH_2101 hypothetical protein
aHOG1303 hbo HBOR08140 Hbor_08140 conserved hypothetical protein TIGR00299
aHOG1303 hla HLAC1654 Hlac_1654 protein of unknown function DUF111
aHOG1303 hmu HMUK1782 Hmuk_1782 protein of unknown function DUF111
aHOG1303 hut HUTA0903 Huta_0903 protein of unknown function DUF111
aHOG1303 hwa HQ3176 hypothetical protein
aHOG1303 hma Hma_11529 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3176|hp|hwa        MSLLVFDGRMGASGDMILAALISAGASADALSPVEDALGIQYVVNTETKAGILATRVHIV
1654|gene|hla      MRTLVFDGRTGAAGDMICAALIAAGADPDALAPVTDRLPVRYEIGETTKNGIRATTVDVL
903|hp|hut         MDTLAFDGRMGASGDMILAALLDLGADPDVLAPVENALGVEFDIDRTTTGGIDAASVDVR
8140|chp|hbo       MRTLAFDGRMGASGDMILASLLAAGADRDALAPVENALDVHYDVSTVVKNGISARRVRVR
2101|hp|hhi        MRTLAFDGRMGAAGDMLLGALLAAGADREALSPVEDALAIEYAVSEVDRCGIAATRVEVL
11529|hp|hma       MRTLAFDGRMGAAGDMLLGALLAAGADRDALSVVEDTLDIEYAVSEVDRRGIAATRVDVL
                   *  *.**** **:***: .:*:  **. :.*: * : * : : :.     ** *  * : 

3176|hp|hwa        SDPESTSAQSNKQSTEVDG-AHQEMTASDAHEDDKSQSD---------------------
1654|gene|hla      LDGDD----DDHDHTHGDGHSHGHSHNHG-------------------------------
903|hp|hut         YAAEA-----------GDG-THEHEH----------------------------------
8140|chp|hbo       LDDTAGGGEGANDGHDADG-GHEHAHEHGDHSHGHEHHHHAHDHSHGEGHTHDHSHGAGH
2101|hp|hhi        LTDAE---------TDSDE-SHDNSGGD--------------------------------
11529|hp|hma       LTNAA---------SDGDG-SQDHAH----------------------------------
                                    *   :                                      

3176|hp|hwa        -------------------------------------DSHIHDTTENDSNTHTHAQNNRQ
1654|gene|hla      -------------------------------------DGDGHD--------HAHEHGHSH
903|hp|hut         --------------------------------------GAEHD--------H--------
8140|chp|hbo       THDHSHGAGHTHDHSHGAGHTHDHSHGAGHTHDHSHGAGHTHD--------HSHGAGHTH
2101|hp|hhi        -------------------------------------AGHSHE--------HTHGDGH--
11529|hp|hma       -------------------------------------DGHSHS--------HTHDEGH--
                                                         .  *.        *        

3176|hp|hwa        QDTDQNKPTHKHVH----ADGHDHSHDE--SVPIEGHGPARTYREVIEIVERMGLNADVE
1654|gene|hla      EHDHSHDHSHDHSH----DHTHDHTHDHAESEHAEGAGVHRTYPEVVALVESMDLLESVE
903|hp|hut         ------DHHHDHAT-----------HEH--ESTVEGHGPTRRYDEVIEVVERMALPDAVE
8140|chp|hbo       DHSHGAGHTHDHSHGDHTEHPHDDDHAH--ETPAEGHGPHRAYAEVVEIVESMGLPNGVE
2101|hp|hhi        ------DHPHSHSH----EHTHDDGHDH---TPAEGHGPSRTYAEVVELVEEMDLPKAVR
11529|hp|hma       ------GHTGDDAH----AHSHD---EH---THAEGHGPSRTYAEVVELVEGMDLPAAVR
                             .                       ** *  * * **: :** * *   * 

3176|hp|hwa        STAIEIFTRLGTAEAAVHGTSLSATQFHEVGTDDAIADIVGAALLLADMDVDRVCVTPVS
1654|gene|hla      SLALDAFERLGRAEASVHGTELDETHFHEVGADDAIADVVGAALLLDDLDPERVVTTPVA
903|hp|hut         ERALSIFARLGTAEAAVHGTDLHATHFHEVGADDAIADVVGASLLLADLDPDKVLTTPLS
8140|chp|hbo       RDAKAIFRILGEAEAAVHGTELDETHFHEVGADDAIADIVGACLLLADLDVERVVTSPLS
2101|hp|hhi        TDALAIFEILGEAEASVHGTDLDDTHFHEVGADDAIADIVGACLLLDDLDAERVVTTPLA
11529|hp|hma       ADALAIFEILGEAEASVHGTDLDDTHFHEVGADDAIADIVGTCLLLDDLDVEQVVTTTPA
                     *   *  ** ***:****.*  *:*****:******:**:.*** *:* :.* .:. :

3176|hp|hwa        TGSGEITMSHGSFSVPPPAVVEIAEEATWSLRGGPVNAELLTPTGAAILAHIAEGVQTLP
1654|gene|hla      TGGGEVEMSHGVYPVPAPATTEVAAGADFSVVGGPIDRELLTPTGAAILAAVAEGADAIP
903|hp|hut         TGDGTVSMAHGTATVPAPAVVEIIADADYSIQGGPIKRELLTPTGAAILAEVADGVETLP
8140|chp|hbo       TGGGEQSMAHGTYPVPTPAVVEIAQRADWSLKGGPVEAELLTPTGAAILAHVAEGVESLP
2101|hp|hhi        TGGGSVEMSHGTYPVPTPAVVEIAERADWSLQGGPIDRELLTPTGAAILAHVADGTESLP
11529|hp|hma       TGGGTVEMSHGTYPVPTPAVVEIAEQADWSLQGGPIDRELLTPTGAAILAHIAEGTESLP
                   **.*   *:**  .**.**..*:   * :*: ***:. ************ :*:*.:::*

3176|hp|hwa        TLTIAATGYGAGGYDFEEYPNVLRVLIGEVPTP-----MGPEASMNTDTIEANNTDRPQP
1654|gene|hla      DLDVDATGYGAGDATFENHPNVLRVLVGE---GRDLEVGGRDHGDAPHHTDDHQTDDHHT
903|hp|hut         TMDVWASGYGAGDHDTGDRANALRVLLGE---T-----AGD-------------------
8140|chp|hbo       TLEIDASGYGAGGYDFPDHPNVLRTLVGD---G-----AGR-------------------
2101|hp|hhi        SLDIDASGYGAGGWDLDDRPNVLRAMVGD---G-----AGR-------------------
11529|hp|hma       PLDINASGYGAGGWDLDDRPNVLRAMVGD---S-----AGR-------------------
                    : : *:*****.    : .*.**.::*:          *                    

3176|hp|hwa        DLETDRLTLDRESIVVLETNLDDATPEVLGSLQETLTDVGARDVTIVPTSMKKSRPGHLI
1654|gene|hla      HG------LVHDDIAVLETNLDDADPEVLGGLQETLSRAGARDVTIVPTTMKKSRPGHLV
903|hp|hut         --------LRRESITVLETNVDDVSPEMLGGLQETLTEAGARDVSILPVTMKKSRPGHLI
8140|chp|hbo       --------LIRDEITVLETNLDDAAPELLGGLQSTLKDVGARDVTILPATMKKSRPGHLV
2101|hp|hhi        --------LRRDEITVLETNVDDVPPEVLGDLQRSLAEVGARDVSIVPTTMKKSRPGHIV
11529|hp|hma       --------LRRDEITVLETNVDDAPPEVLGDLQRSLPDIGARDVSIVPTTMKKSRPGHII
                           * .:.*.*****:**. **:**.** :*   *****:*:*.:********::

3176|hp|hwa        KVITKPDDASSVAQRLAVETGTLGIREHPARHRWRANRTSETVTLTINDNSYEIAVKIGR
1654|gene|hla      KVICKPEDAEAIAERLARETGTLGVRHSGASHRWIAERDFETVTLSIDGGDHEVTVKVAS
903|hp|hut         KVVVKPEDADRVARRLAEETGTLGVREHGAGHRWVAERETRTVDIELDAETYPVDVKVAS
8140|chp|hbo       KVIVKPEDAERVANRLAVETGTLGIREHGAGHRWTASRRFETAELEIEDERHEVAVKVAS
2101|hp|hhi        KVICRPEDAERVARRLAEATGTLGVRESGAGHRWVADREYETVVVSVDGEEFEVTVKIAS
11529|hp|hma       KVICRPEDAERVARRLAEATGTLGVRESGAGHRWVADREYETVVLSVDGEQFEVTVKIAS
                   **: .*:**. :* ***  *****:*   * *** *.*   *. : ::   . : **:. 

3176|hp|hwa        DADGVIYDYSAEYDDALAVATTTDHPVREIRRRAEAAARSIITSDS
1654|gene|hla      TADGDVYDVSAEYDDAAEVAETTGLPIRDVLRQAEREVRDRLDEE-
903|hp|hut         DREGTWLDASAEYEDALSVARETGRPVREVMKRAEQAVGE------
8140|chp|hbo       DAEGAVYDYSAEFDEAQAVADETGLPIREVMRRAENIVAG----DD
2101|hp|hhi        DTDGTVFDVSTEYDDAAAVADATGLPVREVMQRAERMVSR------
11529|hp|hma       DTDGTVFDVSAEYDDAAAVADVTGLPVREVMHRAERMVRE------
                     :*   * *:*:::*  **  *. *:*:: ..**  .