HOG Organism Gene ID Name Annotation
aHOG1300 hhi 945 dapE1 succinyl-diaminopimelate desuccinylase
aHOG1300 hbo HBOR22850 Hbor_22850 acetylornithine deacetylase/succinyldiaminopimelate desuccinylase-like deacylase( EC:3.5.1.16,EC:3.5.1.18 )
aHOG1300 hla HLAC0672 Hlac_672 peptidase M20
aHOG1300 hmu HMUK3165 Hmuk_3165 peptidase dimerisation domain protein( EC:3.5.1.16,EC:3.5.1.18 )
aHOG1300 hut HUTA2692 Huta_2692 peptidase M20
aHOG1300 hwa HQ1512 dapE succinyl-diaminopimelate desuccinylase
aHOG1300 hma Hma_10196 argE succinyl-diaminopimelate desuccinylase
MUSCLE (3.6) multiple sequence alignment


672|gene|hla        MSGAAFDSVSFLEQAVQTPSHESVDEMREFVVETLDQFGAESEVVAGGCVLAKK---Y--
22850|gene|hbo      --MSEFDPVAFLERAVPVASNEDVAEMRELLVETLASHGVEPTVDDAGNTLASK---G--
1512|gene|hwa       --------------------------MRELLVGTLQQYDIDVHVDSAGNTIATR---GIK
2692|gene|hut       ---MAFDILDFHEQAVRTESQESVEAMRSVLVETLEDDGVSVRVDGGGNVVAHRSGSG--
945|gene|hhi        ---MAFDIPSFHRQAVETPSHERVDDMRSLLVDTLEDAGEYPEIDDLGNVVVSR---G--
10196|gene|hma      ---MAFDIPSFHRRAVETRSDEHVDDMRSLLVDTLEDAGEYPEIDDLGNVVVSR---G--
                                              **..:* ** . .    :   * .:. .      

672|gene|hla        ------------SDAPGEGPHLVLNTHLDTVTPHVPFE-----R--GEAHEDERADSVSD
22850|gene|hbo      ------------DDDPER--HLVFNTHIDTVSPHVPFE-----RRDG---------RGDG
1512|gene|hwa       RDSTTNDCANSNNSESTRETHLVFNTHIDTVSPHIPLDQSRSSRSVSSNTDTHPRSQNAA
2692|gene|hut       ------------ETDDTS--HLLLNTHLDTVPPHVPFE-----R----------------
945|gene|hhi        ------------DTDGT---HILLNTHIDTVPPHLPYE-----RRTEPPGPDESIDGSGG
10196|gene|hma      ------------DEDGT---HILLNTHIDTVPPHLPYE-----RRTEPPGPDETIDGTGG
                                .       *:::***:***.**:* :     *                

672|gene|hla        DGPGDV--------------------------IRGRGACDAKGPLAALLSGFLAADPERG
22850|gene|hbo      DDSDDV--------------------------IRGRGSCDAKGPLAAILAAFFAVEPADG
1512|gene|hwa       TTSGDTVTDKKSRSAESMVANSSTESANEPARIHGRGACDAKGPLAAMLAAFLRVDVSSK
2692|gene|hut       --DGEI--------------------------VRGRGACDAKGSLAAMVGAFLRAEIGDG
945|gene|hhi        DGDGDI--------------------------VCGRGACDAKGPLAALLDAFLTVTPDNG
10196|gene|hma      DGDGDI--------------------------VCGRGACDAKGPLAALLDAFLTVTPDDG
                       .:                           : ***:*****.***:: .*: .     

672|gene|hla        -RITLALTPDEESLSLGAAALTGRSPGTEDRLNGDL--FLVGEPTSLDACTAAKGRFQGT
22850|gene|hbo      ARVTVAVTPDEEVLSTGADALD---------LDADL--YIVGEPTGLDVCTAAKGRFQGT
1512|gene|hwa       ATITLAVTPDEEVLSTGAAALD---------LDADM--YIVGEPTGLDVCTAAKGRFQGT
2692|gene|hut       -RVTLAITPDEETTQTGAAHLV-------ETLDADLDAAIVGEPTDLDVCYAARGQFEGQ
945|gene|hhi        -RVTLAISTDEETTQTGGAHLA-------DTVDADG--YIVGEPTGLDVCTAARGQFEGT
10196|gene|hma      -RVTLAISTDEETTQTGGAHLA-------DTIDADG--YIVGEPTGLDVCTAARGQFEGT
                      :*:*::.***  . *.  *          ::.*    :*****.**.* **.*.*:* 

672|gene|hla        VELSGTAAHAAEFA-GANAVAAAEGALAAIRTFDDGADE--HPQLGPPKLTPTVIEGGGA
22850|gene|hbo      LRLSGVASHAAEPASGVNAVFALEQALTAIRSFDDGRDE--HPQLGAATLTPTTVEGGES
1512|gene|hwa       LTLTGTAAHAAAPTSGVNAIAALEDALKAIRTYDTDQPNAIHPQLGKPTVVPTTVDGGTA
2692|gene|hut       ITLTGESAHASDPSDGINAVRVIGPTIESMDRYDDARGTAAHDTLGSPTLTPTMVEGGEA
945|gene|hhi        VTIHGESAHAADPGSGHNAIRAAAPILQAMEAYDEKTGPGEHETLGYPILTPSMVEGGEA
10196|gene|hma      VTIHGESAHAADPGSGHNAIRAAAPILQAMESYEEKKGPGEHETLGYPILTPSMVEGGEA
                    : : * ::**:    * **: .    : ::  ::       *  ** . :.*: ::** :

672|gene|hla        TNQVPADCEITADRRSVPPETAEGFRSSLADAVRESTPKDIGVAVALTDRESPFFEAFST
22850|gene|hbo      TNQVPAECRLVLDRRSVPPETAEEFRSSLESAVRDAVPDDVGVEFSLTDRPTPFLEAFAT
1512|gene|hwa       TNQVPATCRVVLDRRSVPPETADTFQDKLTTAVNTAVSEDVGVDFSLTDRPTPFLEAFAT
2692|gene|hut       PNQIPAEVRITFDRRSVPPERSEDFPASLEAHLRNLLPDEIGVDVSLVRPDTPFPEAFET
945|gene|hhi        TNQVPAECTITFDRRSVPPETSESFCADLQAHLEQWLPESMDLTVDLIRPDTPFPEAFAT
10196|gene|hma      TNQVPAECTITFDRRSVPPETSESFCADLQAHLEQWLPESMGLTVDLIRPDTPFPEAFAT
                    .**:**   :. ******** :: *  .*   :    ...:.: . *    :** *** *

672|gene|hla        DPDHELVGAVANAARIAADSTGILADRGGAVRPFGAATEASYFAP-APTVVFGPGDLADN
22850|gene|hbo      DDDHELVQTVAAASRRAGGS--------GDVRPFTAATEASYFSP-APVVVFGPGVLADD
1512|gene|hwa       NPDHKLVTTLIDATKQTGES--------AQQRCFTAATEASYFSP-APVVVFGPGVLADD
2692|gene|hut       DPDAQIVEVLRDASG-------------GSVRPFGAATEAAQFAKLAPTVVFGPGVLADD
945|gene|hhi        DTDAELVRTLQEASG-------------GGVRQFGAATEASYFASNGPTVVFGPGDLSDE
10196|gene|hma      DTDAELVRTLQEASG-------------GGVRQFGAATEASYFANNGPTVVFGPGDLSDE
                    : * ::* .:  *:              .  * * *****: *:  .*.****** *:*:

672|gene|hla        AGAVAHAEREYVRVREVEAAAKTVERSIAALLGDAGATAADDAV---
22850|gene|hbo      HGAVAHAEREYVRTDAVRRAATALTDAATELVGDT------------
1512|gene|hwa       TGAVAHADREYVTVSSVISAARALTDATQQLI---------------
2692|gene|hut       EGPVAHSPREYVDRQDVLRTADVLVETIETMLAVGDQPAERDASSSF
945|gene|hhi        IGAVAHSKREYVRLSEVRTAARAVRETVERLI---------------
10196|gene|hma      TGAVAHSKREYVRLSEVRTAARAVRETVERLV---------------
                     *.***: ****    *  :* .:  :   ::