HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0130COG3390arCOG02257Uncharacterized protein conserved in archaeareplication factor A related protein - rfa32

HOG Organism Gene ID Name Annotation
cHOG0130 nrc1 VNG2162 rfa8 replication factor A related protein - rfa32
cHOG0130 hmu HMUK1028 Hmuk_1028 conserved hypothetical protein
cHOG0130 hma RRNAC2745 hypothetical protein
cHOG0130 hma PNG2008b hypothetical protein
cHOG0130 hwa HQ3264A hypothetical protein
cHOG0130 hla HLAC0137 Hlac_137 hypothetical protein
cHOG0130 hbo HBOR28820 Hbor_28820 uncharacterized conserved protein
cHOG0130 hut HUTA1630 Huta_1630 conserved hypothetical protein
cHOG0130 hvo HVO_0291 HVO_0291 conserved protein
cHOG0130 nph NP1280A hypothetical protein
cHOG0130 hhi 32 HAH_0032 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2008|hp|hma        MSQGQAPMRELAQRAFAGEFNDAGYTFRESDDDRAPVYALLPTGAKANRVFVVGTLTETD
1630|chp|hut       --MAATPTREVARRVFAGEFNDATYTFKESDDDRAPVYVLLPTGERANRVFIVGTLTETE
12745|hp|hma       --MASTPTREVARRVFAREFNDASYTFKESDDDRAPVYVLLPTGQRANRVFLVGTLTETE
32|hp|hhi          --MASTPTREVARRVFAREFNDASYTFKESDDDRAPVYVLLPTGQRANRVFLVGTLTETE
1280|hp|nph        -MSDSEPSREVARRAFAAEFNDATYVFKESDDERAPVYSLLPTGERANRVFIVGTLTETE
2162|chp|nrc1      --MSGAPTREVARRVFAAEFNDATFTFKESDDERAPLYALLPTGERANRVFVTGTLTETE
137|hp|hla         -MSQSAPTREVARRVFATEFNDAGFTFTESDDERAPVYALLPTGESSNRVFFVGTLTEKE
3264|hp|hwa        MSTEDIPTREVAKRAFATEFNDAGFSFKESDDERAPVYLLFPTGAKANRVFLIGTLTETE
28820|hp|hbo       MSSNEVPTREVARRVFAEEFNDASYTFKESEDERAPVYLLLPTGEKANRIFLVGTLTEKD
                         * **:*.*.** ***** : * **:*:***:* *:***  :**:*. *****.:

2008|hp|hma        DVGSDDEYWQGRIVGPTG-TFFTYAGQYQPEAAAMLREVDPPVFVALVGKPRTYETDDGD
1630|chp|hut       DVGEDSEYWQGRIVDPNGDTYFAYAGQYQPDAASMLRELEPPAYVSIVGKPRTYETDDGE
12745|hp|hma       DVGEDSEYWQGRVVDPNGDTFFMYAGQYQPDAASMLRELEPPAYVAVVGKPRTYETDEGE
32|hp|hhi          DVGEDSEYWQGRVVDPNGDTFFMYAGQYQPDAASMLRELEPPAYVAVVGKPRTYETDEGE
1280|hp|nph        DIGEDSEYWRGRIVDPTG-TFFTYAGQYQPEATSVLREAETPAYVAVVGKPRTYETDSGE
2162|chp|nrc1      DIGEDAEYWRGRVVDPTG-TFFVYAGQYQPEAAAALRDAETPTYVAVVGKPRTYETDDGS
137|hp|hla         DVGEDAEYWRGRIVDPTG-TFFVYAGQYQPEAASKLRDLEPPAYVAVVGKPRTYETDDGT
3264|hp|hwa        DVGEDNEYWRGRIVDPTG-TFFVYAGQYQPEAAQELRELTPPAYVAVSGKPRTFETDDGT
28820|hp|hbo       DVGEDNEYWRGRIVDPTG-TFFVYAGQYQPEAASMLRDLEPPAYVAVVGKPRTYETDDGN
                   *:*.* ***.**:*.*.* *:* *******:*:  **:  .*.:*:: *****:***.* 

2008|hp|hma        TNVSLRPEHLTVVDADTRNRWVTETAKRTLERIQRFDDDT--------NEYAAMAREEYD
1630|chp|hut       VNVSIRPESITPVDETTRNRWVVETAERTLERVQGYQEADPTQDDYAADEYVQMAHDEYE
12745|hp|hma       VNVSIRPESISKVDEATRDRWVVETAERTLDRVKRYKEAD--MEDPATDEYISMADEEYD
32|hp|hhi          VNVSIRPESISKVDEATRDRWVVETAERTLDRVKRYKEAD--MEDPATDEYISMADEEYE
1280|hp|nph        VNVSLRPESITVVDGATRDRWVAETAERTVERIEAFDSAH---------EYAAMAETQYD
2162|chp|nrc1      VNVSLRPESITMVEESVRDRWVVEAAERTLDRIEAFNEEG--------NEYAERARAEYG
137|hp|hla         VRVSVRPESITEVDANTRDRWVAETAKRTIERAAAFDDEG--------NEYARMAREEYD
3264|hp|hwa        TNVSVRPESITVVDATTRDRWVVETAERTLDRIAAFEDEG--------NEYARMANDEYE
28820|hp|hbo       VNVSVRPESISVVDAATRDRWVVETAERTLERIETFDNEG--------NEYARMAREEYE
                   ..**:*** :: *:  .*:***.*:*:**::*   :..           **   *  :* 

2008|hp|hma        -TDPDQYRQTVIQALEELTDDAETVPTSQDQAGGVTPSTAEDASGSATEVSTDEDSTSQS
1630|chp|hut       -PAVENYRRLVVEALESL-EEETAEPEA--------------------------------
12745|hp|hma       QLSIENYRQSVVGALESL-QDEQAEASAD-------------------------------
32|hp|hhi          QLSIENYRQSVVGALESL-QDEQAEASAD-------------------------------
1280|hp|nph        -PDLSVYRDQAIAALEDL-ETDAEQPAEA-------------------------------
2162|chp|nrc1      -ADTSAYRQAVVDALAEF-DAPE-------------------------------------
137|hp|hla         -LDPETYKAAALSALEDL-DESDGDELAGDGSEGDDTATDDTASDDTAPDGSDSAGTPEP
3264|hp|hwa        -IPIDQYIESTVSAVESL-DESTDELNTASTEGTAQNL----------------------
28820|hp|hbo       -LPTDRYQSAAVSALQSL-DETGDDELGSDELGDDTASPEPDA-----------------
                       . *   .: *: .: :                                        

2008|hp|hma        GDDIGDFDTTDLDS
1630|chp|hut       --------------
12745|hp|hma       --------------
32|hp|hhi          --------------
1280|hp|nph        --------------
2162|chp|nrc1      --------------
137|hp|hla         --------------
3264|hp|hwa        --------------
28820|hp|hbo       --------------