HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0013COG2322arCOG02864 arCOG02865Predicted membrane proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0013 nrc1 VNG0671 vng671 no entry
cHOG0013 nrc1 VNG1492 vng1492 no entry
cHOG0013 hmu HMUK2804 Hmuk_2804 protein of unknown function DUF420
cHOG0013 hmu HMUK2094 Hmuk_2094 protein of unknown function DUF420
cHOG0013 hma RRNAC0795 hypothetical protein
cHOG0013 hma RRNAC3548 hypothetical protein
cHOG0013 hwa HQ1559A hypothetical protein
cHOG0013 hwa HQ2877A hypothetical protein
cHOG0013 hla HLAC1474 Hlac_1474 protein of unknown function DUF420
cHOG0013 hla HLAC0654 Hlac_654 protein of unknown function DUF420
cHOG0013 hbo HBOR23940 Hbor_23940 predicted membrane protein, COG2322
cHOG0013 hbo HBOR11840 Hbor_11840 predicted membrane protein, COG2322
cHOG0013 hut HUTA2961 Huta_2961 protein of unknown function DUF420
cHOG0013 hut HUTA0671 Huta_0671 protein of unknown function DUF420
cHOG0013 hvo HVO_0823 HVO_0823 Protein of unknown function (DUF420) family
cHOG0013 nph NP2436A hypothetical protein
cHOG0013 nph NP4148A hypothetical protein
cHOG0013 hhi 2597 HAH_2597 hypothetical protein
cHOG0013 hhi 1440 HAH_1440 hypothetical protein
cHOG0013 hhi 760 HAH_0760 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2597|hp|hhi        --------------MRR--------LPTFGWAFLVSIWAGLVGGAVI---HEPSVDLVP-
671|hp|hut         ------MRSI----VRRRTVELTVVLTVGSLALIFGVVGGVVPSSWLP--HTAAVDVLAH
1492|chp|nrc1      ---MGMADGF----VRRHVAGLAAVLGVASIAVVVAAVRGVIPAGVLPQAPAWFIGAIPP
2877|hp|hwa        ------MALR----IRNHIPGLTAALTILSLAAVFAAVLGVIPQSSLPRAPEPLIELIPH
11840|hp|hbo       ------MAFR----VRDNVPGVAAALSVVSLALVFGAVLGYIPASLLPHVSESALDLIPH
1474|gene|hla      ------MSEW----ARENVPLLTALLSVVALALVFGAVGGVIPSSVLPRASDTVLAALPH
4148|hp|nph        ----MKLRAW----TREHVLGITVVLSVVSLTLVFGAALQAVPTDPLPK-PQPLLDAIPH
10795|hp|hma       ------MDLQ----ARYRVPALTGLLTVVSLALVFGAVLGAIPQSALPAAPASVLGAIPH
1440|hp|hhi        ------MDLQ----ARYRVPALTGLLTVVSLALVFGAVLGAIPQSALPAAPASVLGAIPH
2436|hp|nph        -MSTASAPSF----ARNHPKALATVVTLVGYVVVIGTLYGDFG--LYPEISESTVDLLAH
13548|hp|hma       MAVADTLQSR----ARARPRLVTAVVSVVGYALVFGAFGGVLP---LPEFSKDIVILLGD
760|hp|hhi         MAVADTLQSR----ARARPRLVTAVVSVVGYALVFGAFGGVLP---LPEFSNDTVILLGD
671|hp|nrc1        -MVSVRAASY----AKANPGRVTIVLSVLGYALVAGAFTDVVA--LFPPLDDPTVLLFAD
2961|hp|hut        --MQTDSGSWLRRVARERPLGVTAVLSAIGYALVAGAFAGAIP--LFPPLDRSTVNLFGH
654|gene|hla       -MSTARVRDR----AKERAGAITVLLTIIGYGAVGGVFLVPQFQALFPELTRSTVDLFAH
1559|hp|hwa        -MATASAEMS----LKRHPLAATIILSVVGYAVVIGTFIGIVPAQIYPDLSLTEVNIISD
23940|hp|hbo       -MATASADNP----LKEHPLAATVVLSIVGYALVIGTFLGFVPGSVFPELSLSQVNLLSD
                                  .         :   .   : .                  :  .  

2597|hp|hhi        -LYAVTCQLIGLVVAYWTMRERDDILESVHRPGRVGMFIIVLFFVMVPLSTI--------
671|hp|hut         VNAVLSVLALVSIGAGVLAVRRGDIDA--HRRRMGAAFALFVAFLASYLYRIT-VAGTQP
1492|chp|nrc1      LNAVISAAAIGTILAGWRWIRRGDVAK--HRAAMATTTLLFVAFLGLYLYRLV-VHGTTA
2877|hp|hwa        INAIISTIAVMTILLGVRFIRHGSVRR--HRAMMLTSVGLFIMFLILYLYKVI-LKGPAE
11840|hp|hbo       VNAVLSTTAIVTIVLGVRAIRRGNVAR--HRALMLSTLGLFIGFLVLYLYRLTILEGPTE
1474|gene|hla      LNAAISATAIGTILVGWRAISRGNVDR--HKAFMLSSFGLFAAFLVSYLYRLI-LVGTVE
4148|hp|nph        ANAVISLAAIGTILGGVYEIRRGNVDR--HRLLMVASFLLFAGFLVLYLYRVA-IVGPSA
10795|hp|hma       ANAVVSALAIGTIIGGVRAIRRGNIAR--HRKLMLSSFGLFALFLVLYLYRIT-LVGPTD
1440|hp|hhi        ANAVVSALAIGTIVGGIRAIRRGDVAR--HRKLMLSSFGLFALFLVLYLYRIT-LEGPTD
2436|hp|nph        AIAVVNAATIACLVAGIYWIRADEIQK--HRAAMLAAFGLILVFLVLYLLKTG-GGGRKE
13548|hp|hma       AIAVVNSIALLAIVAGVYFIKNNEVQK--HRAAMLTAFTLIMVFLALYILKVG-GGFEKE
760|hp|hhi         AIAVVNSIALLAIVAGVYFIKNDQVQK--HRAAMLTAFTLIMVFLALYILKVG-GGFEKE
671|hp|nrc1        LIAVVNTLALTSLLAGVAFIKRGAVRK--HRAAMLTAFTLICVFLVLYLWKVG-GGFEKS
2961|hp|hut        LIAVVNASALSAILAGVYFIKHDEVEK--HRAAMLTAFALIAVFLVLYLWKVG-GGFEKS
654|gene|hla       AIAAVNTVTIVTLSLGWYWIRNGEVKK--HAAAMTTSFTLILVFLGLYLPKVA-GGGTRE
1559|hp|hwa        AIAVVNAVNVIVILAGWRWIRRNEVRK--HAAAMLTSFGLILIFLVLYLTKIG-GGGTKE
23940|hp|hbo       AIAAVNAVNVIVIAAGWRWIRRDEVKK--HATAMVTSFALILVFLVMYLAKIG-GGGTKK
                       :.   :  :         . :    *         :.  *:   :           

2597|hp|hhi        ----------------------------------------FALWLGATSIPG--------
671|hp|hut         FTGP---------GVLE-PVYLVILAVHVTLAIVCLPLLYYVLLLAAAYDRRELP-ETSH
1492|chp|nrc1      FPTT---------GAVYTFVYLPVLIIHMGLAIACIPLVYYVLLLAGTRPVSEIY-DSNH
2877|hp|hwa        FLGP---------DVIYQYIYMPTLAVHILLAIVCIPLLYYVALIALSRPIEAIY-ESRH
11840|hp|hbo       FPSQ---------GVVYQFVYLPTLAVHILLAIVCIPLLYYVLLLAVTRPIEEIY-ETRH
1474|gene|hla      FPGP---------EAVYSYVYLPFLAIHILLAIVCLPFVFYALLLAATRPYEDLY-HTRH
4148|hp|nph        FPGG---------ETVRTFVYLPFLAVHIVLAVACVPFVFYALLVAGTRPVEEIY-RTNH
10795|hp|hma       FTGP---------SVVETYFYLPFLAVHILLAIIAIPAVYYVLLLAYTYPVSELP-STNH
1440|hp|hhi        FTGP---------AVVETYFYLPFLAIHILLAIIAIPAVYYVLLLAYTYPVSELP-STNH
2436|hp|nph        ILAG---------EPLR-GAYLAMLGIHIFLSVVAVPFVLYAITLGLTRTPTELK-STAH
13548|hp|hma       IVAE---------GFVW-TAYIVMLAIHILLSAVSVPVVVHAVVLGLTHSPAELR-ETIH
760|hp|hhi         IVAE---------GIVW-TAYIVMLAIHILLSAVSVPVVVHAVVLGLTHSPAELR-ETIH
671|hp|nrc1        IVITQGMFLGQFAGVVK-GAYLLMLAVHILLSVVSVPVVLYAIVLGLTHSPAELK-RTRH
2961|hp|hut        ITVT---------GPPE-IAYLLMLAVHIILSVVAVPVVLYAVILGLTHTPAELR-STAH
654|gene|hla       FVLESAYAWVPLWDWIY-YAYLLMLAIHIILSVVAVPVVLYAVVLGLTHTEAELRNETPH
1559|hp|hwa        FVGP---------AVAY-YPYLGMLAIHILLSIISVPVVLYAIVLGITHTPQELREQTPH
23940|hp|hbo       MVAP---------WFAY-YPYLAMLAIHIILSIVAVPVVLYALVLGLTHSPTELRRETPH
                                                           ..  :. :            

2597|hp|hhi        ------VATQWLSYLMGLGSALYVAFAGG-FDRAWEEYT---------------------
671|hp|hut         PRIGRIAAPLWAISFT-LGLVVYVVLYIAPW-----------------------------
1492|chp|nrc1      ARVGRVAASLWLVSFA-LGIVVYLMLYVL-Y-----------------------------
2877|hp|hwa        KIVGRVAASLWLISFV-LGNVVYVMLYVV-Y-----------------------------
11840|hp|hbo       KTVGRVAASLWLVSFV-LGDVVYTLLHLV-N-----------------------------
1474|gene|hla      AQIGSVAAVLWLISFT-MGIGVYLMLYHA-F-----------------------------
4148|hp|nph        RTAGRIAAALWLISFS-MGIVIYLMLYHI-Y-----------------------------
10795|hp|hma       PRAGKLAASLWLISFS-MGIVVYAMLYLV-W-----------------------------
1440|hp|hhi        PRAGKLAAGLWLISFS-MGIAVYAMLYLV-W-----------------------------
2436|hp|nph        ATVGRIAVTTWLVSLV-LGIVAYLMLTFY-YGPEQVEFVRGMA-----------------
13548|hp|hma       ARVGRIAVSAWGLSLF-LGLVTYVMLNHI-YGWVPR------------------------
760|hp|hhi         ARVGRIAVSAWGLSLF-LGLVTYVMLNHI-YGWVPR------------------------
671|hp|nrc1        ATFGRIAATAWSLSLF-LGVVTYVMLNHV-YAWVPR------------------------
2961|hp|hut        ARVGRIAVAAWSISLF-LGIVTYVMLNHV-YGWVPRESMLLLVAVPRPVWDLGGESGGRE
654|gene|hla       RRVGRIAASAWLLSLV-LGVVTYLMLNHA-YDSTFAAAEAAAMLLPVGPGA---------
1559|hp|hwa        RRVGRIAASAWVLSLT-LGVVAYVLLNHT-FGWEYIESGTAVILTMIMILV---------
23940|hp|hbo       LKVGRLAAGSWLLSLS-LGVITYLLLNHV-FSWEYSASAAAALVAAPL------------
                         ..  *   :  :*   *  :