HOG Organism Gene ID Name Annotation
aHOG1297 hhi 2261 valS valyl-tRNA synthetase
aHOG1297 hbo HBOR03120 Hbor_03120 valyl-tRNA synthetase( EC:6.1.1.9 )
aHOG1297 hla HLAC0018 Hlac_18 valyl-tRNA synthetase
aHOG1297 hmu HMUK1536 Hmuk_1536 valyl-tRNA synthetase( EC:6.1.1.9 )
aHOG1297 hut HUTA0205 Huta_0205 valyl-tRNA synthetase
aHOG1297 hwa HQ1051 valS valyl-tRNA synthetase
aHOG1297 hma Hma_11729 valS valyl-tRNA synthetase
MUSCLE (3.6) multiple sequence alignment


18|gene|hla         ------------------------------MPSGEYDPDTVEPRWQRRWVDEETYAYPD-
3120|gene|hbo       ------------------------------MPSGEYDPETVEAKWQDRWVDEDTYSYDD-
1051|gene|hwa       ------------------------------MPSGEYDPDAVETKWQDRWVDEETYTYASS
205|gene|hut        --------MSTEHETDDEPTDESTPDP---ALAGDYDPRETEPRWQDYWVDNDVFAYEE-
2261|gene|hhi       -----------MSDTQDPPQDESTADESENALDGEYDPREVEPEWQDQWVADKTYAYDE-
11729|gene|hma      MLPGCYTHRLNMSDTQDPPQDESTTDESADALDGEYDPREIEPEWQDQWVADKTYAYDE-
                                                     *:***   *. **  ** :..::* . 

18|gene|hla         ----------------------------------DDPVDPNTVFSIDTPPPTVSGSLHMG
3120|gene|hbo       -----------------------------------SAVDADTAFSIDSPPPTVSGSLHWG
1051|gene|hwa       IVSASDSEFDPHLASESESSDEHTLDNSSDGAHVDIEADPDTAFSIDSPPPTVSGNLHWG
205|gene|hut        ----------------------------------SETPDADTQFTIDTPPPTVSGSLHMG
2261|gene|hhi       --------------------------------------DADTRFTIDTPPPTVSGNLHMG
11729|gene|hma      --------------------------------------DADTRFSIDTPPPTVSGNLHMG
                                                          *.:* *:**:*******.** *

18|gene|hla         HLYGFTLQDFVARFERMNGGETFFPFGYDDNGIASERLTEDELDIRHQDFERREFQAKCR
3120|gene|hbo       HAYGFTLQDFVARFNRMRGKEVFFPFGFDDNGIASERLTEDELDVRHQDYDRREFQEMCR
1051|gene|hwa       HVYGFTLQDFVARFKRMRGSDVFFPFGYDDNGIASERLAEDELNVRHQEYERREFQQMTQ
205|gene|hut        HLYQFTLQDFVARFRRMTDDTVYFPFGYDDNGIASERLTERELDIRHSDFERREFQEKTR
2261|gene|hhi       HLYQFTLQDFVARFHRMRDDTVYFPFGYDDNGIASERLTERELGIRHQDYPRREFQEKCR
11729|gene|hma      HLYQFTLQDFVARFHRMRDDTVYFPFGYDDNGIASERLTERELDIRHQDYPRREFQEKCR
                    * * ********** ** .  .:****:**********:* **.:**.:: *****   .

18|gene|hla         EVCAEYEAQFTENVQSLGVSVDWDHTYQTIEPRVQRISQLSFLDLYDQGREYREKAPAIW
3120|gene|hbo       EVCEQYEAEFTEKMQNLGISIDWDQTYQTISPEVQRASQLSFIELYDDGREYRQRAPAIW
1051|gene|hwa       EVCQQYEAEFTEKMQQLGISIDWNQTYQTISSDVKRTSQLSFIDLYEQGREYRKRAPTIW
205|gene|hut        DVCADYEDAFTEDVQSLAISVDWDNTYKTIEPRVQRISQLSFLDLYEQGKEYRQRAPTIW
2261|gene|hhi       TVCTEFEDEFTEDVQSLAISIDWDNTYKTIAPDVQRVSQLSFLDLYEQGREYRQRAPTIW
11729|gene|hma      DVCTQFEDEFTQDVQSLAISIDWDNTYKTIAPDVQRVSQLSFLDLYEQGREYRQRAPTIW
                     ** ::*  **:.:*.*.:*:**::**:** . *:* *****::**::*.***:.**:**

18|gene|hla         CPECETAISQVETEDDEQASHFHDIAFPVV--GGDATDDGAEEFVISTTRPELLPACVAV
3120|gene|hbo       CPECETAISQVETEDDEQGSHFHDIEFEVV--------DSEEEFVISTTRPELLPACVAV
1051|gene|hwa       CPECETAISQVETEDDEQPSHFHDIAFELINKNNPRSEHRTDTFTISTTRPELLPACVAI
205|gene|hut        CPDCETAISQVEQEDTEQHTTFNDIEFPLVADGNGEADDG-ETLTISTTRPELLPACVSI
2261|gene|hhi       CPDCETAISQVEQEDKDKHTKFNDIAFDLVETGEGPADEG-ATFTISTTRPELLPACVAV
11729|gene|hma      CPDCETAISQVEQEDKDKHTKFNDIAFDLVETGEGPADED-ATFTISTTRPELLPACVAV
                    **:********* ** :: : *:** * ::             :.*************::

18|gene|hla         FVHPDDDENQNLVGESAEVPLFGHEVPIIADERVDMETGSGIVMCCTFGDQNDIEWYQVH
3120|gene|hbo       FVHPDDEENQHLVGEEARIPLFGQEVPIIEDERVDLETGSGIVMCCTFGDQTDIEWYQAH
1051|gene|hwa       FVHPDDDDNQDLVGADARVPLFDQTVPIIADERVDMETGSGIVMCCTFGDQTDIEWYQAH
205|gene|hut        FVHPDDDANAHLVGGTAEVPLFGQEVPIIEDERVDLETGSGVVMCCTFGDQTDIEWYQAH
2261|gene|hhi       FVHPDDDENQHLVGGSARVPIFEQEVPIIADERVDMETGSGIVMCCTFGDQNDIEWYQAH
11729|gene|hma      FVHPDDDENQHLVGGSARVPLFEQEVPVIADERVDMETGSGIVMCCTFGDQNDIEWYQAH
                    ******: *  ***  * :*:* : **:* *****:*****:*********.******.*

18|gene|hla         DLNLRVAIDESGHMTDVAEGYEGMHADEAREAIVEDLDGAGALLDRRDITHTVNVHERCG
3120|gene|hbo       NLDLRIAIDESGTLTDVAGEYEGLSSEEAREAIVSDLDDDGALLDKRAITHTVNVHERCG
1051|gene|hwa       DLDLRIAIDESGTMTDVAGSYSGLDSTEARESIVADLSESDALLDRREITHTVNVHERCG
205|gene|hut        DLPLRIAIDESGTMTDRAGEYEGLSTTEAREAIIADLDDAGHLLESRDHHHSVQVHERCE
2261|gene|hhi       DLPLRLAIDESATMTDLAGEYEGMHTTEAREAIIEDLGEEGSLLESRDHDHTVQVHERCE
11729|gene|hma      DLPLRLAIDESATMTDVAGEYEGMHTTEAREAIIEDLREEGSLLESRDHDHTVQVHERCE
                    :* **:*****. :** *  *.*: : ****:*: **   . **: *   *:*:***** 

18|gene|hla         TSVEFLVTEQWYVEMLDKTDEYLEIGREMEWSPEKMFTRYEHWVEGLQWDWLISRQRSSG
3120|gene|hbo       TGVEFLVKDQWYVELLDKTDEYLEAGREMDWYPEKMFTRYKNWIEGLQWDWSISRQRSSG
1051|gene|hwa       TNIEFLVKDQWYVKLLDKTDEYLTAGREMEWYPEKMFTRYKNWIEGLQWDWAISRQRSSG
205|gene|hut        TEVEYLVTEQWYVDMLDSTEEYLEAGREMDWYPEKMFTRYKHWIEGLEWDWCISRQRDSG
2261|gene|hhi       EEVEYLVTEQWYIELLDKKEEYIEAGRQMEWFPEKMATRYEHWIEGLEWDWCISRQRDSG
11729|gene|hma      EEVEYLVTEQWYIELLDKKEEYIEAGRQMEWYPEKMATRYEHWIEGLEWDWCISRQRDSG
                      :*:**.:***:.:**..:**:  **:*:* **** ***::*:***:*** *****.**

18|gene|hla         IPFPVWYCEDCGEIVVAEKADLPVDPLSDDPPVDACPECGHDEFEPEDDVLDTWATSSLT
3120|gene|hbo       IPFPVWYCDDCEHVVVAERENLPVDPLSDDPPVDTCPECDHDEFVPEDDVFDTWATSSLT
1051|gene|hwa       IPFPVWYCDACEHVVIAEKESLPVDPLSDNPPVESCPACNHDTFIPEDDVFDTWATSSLT
205|gene|hut        IPFPVWYCEDCGEPVFADREDLPVDPLSDDPPVDSCPECGGADFEPESDVFDTWATSSLT
2261|gene|hhi       IPIPVWYCDDCGEPVMAEREQLPVDPLSDDPPVDACPHCGHDSLTPEEDVFDTWATSSLT
11729|gene|hma      IPIPVWYCDDCGEPVMAEREQLPVDPLSDAPPVDSCPECGHDSLTPEEDVFDTWATSSLT
                    **:*****: *   *.*:. .******** ***::** *.   : **.**:*********

18|gene|hla         PLINAGWDWDE-----------DAGEFTMEHPELYQFDLRPQGHDIISFWLFHTLVKCYE
3120|gene|hbo       PLINAGWDWDE-----------DAEEIVIDREELYPFDVRPQGHDIISFWLFHTVVKCYE
1051|gene|hwa       PLINAGWDWND-----------NTETIEFGDSGLYPFNLRPQGHDIISFWLFHTVVKCYE
205|gene|hut        PLINAGWDWQPADESAETADSVDAGEFTFDNPELYPMNLRPQGHDIISFWLFHTVVKCYE
2261|gene|hhi       PLVNAGWDWDS-----------ESEGFTWDNPELYPFDLRPQGHDIISFWLFHTVVKCYE
11729|gene|hma      PLVNAGWDWDA-----------DSESFTMELPELYPFDLRPQGHDIISFWLFHTVVKCYE
                    **:******:            ::  :      ** :::***************:*****

18|gene|hla         HTGEVPFEETMINGHVLDENREKMSKSVGNVVEPEAVLAEFPVDATRYWAAGTAVGDDFP
3120|gene|hbo       HTGEVPFDSVMINGMVLDENREKMSKSKGNVVSPDEVMSKYPVDAARYWAAGSAVGDDLP
1051|gene|hwa       HTGEVPFDSVMINGMVLDENREKMSKSKGNVIAPDEVITEYPVDAARYWAAGSAVGDDLP
205|gene|hut        HTGEIPFDTVMVNGMVLDENREAMSKSKGNVVSPEAVLEDFPVDATRYWAAGTSIGDDFP
2261|gene|hhi       HTGEVPFENVMINGMVLDENREAMSKSKGNVIPPSEVLEEFPVDATRYWAAGTSIGDDFP
11729|gene|hma      HTGEVPFENVMINGMVLDENREAMSKSKGNVIPPSEVLEEFPVDATRYWAAGTSIGDDFP
                    ****:**: .*:** ******* **** ***: *. *: .:****:******:::***:*

18|gene|hla         FKEKDLRAGEKLIRKLWNASKLVESLAPE-PYPDTPADEDLRELDRWLLAELDDRIERLT
3120|gene|hbo       YSEKGLRAGEKLLRKLWNASKLVDSLSED--APESFDHDDLKQIDRWLLASLDREIEHVT
1051|gene|hwa       YSEKGIRAGEKLLRKLWNASKLVEDLTTDAPDPETMSHADLEAIDRWLLARIDTEIDRLT
205|gene|hut        FKENDLEAGERLLQKLWNASKLVDQLAPG-NNYEEP--EDLAAIDEWLLAKLDDTIESLT
2261|gene|hhi       YKEGDLEAGERLLQKLWNASRLVDQLTPA-AQPDEP--EKLAAVDEWLLAELDATVESVT
11729|gene|hma      YKEGDLEAGERLLQKLWNASRLVDQLTPA-ARPDEP--EELAAVDEWLLAELDATVESVT
                    :.* .: ***.*:.******.**:.*:      :     .*  :* **** :*  :: :*

18|gene|hla         GLFEDRAFSKARDELRSFFWNTFCDDYLEIVKQR-----------------------EDD
3120|gene|hbo       EKLQNREFSKARDDLRSFFWNTFCDDYLEIAKQRVR-----------------ES--DDE
1051|gene|hwa       EKFESREFSKARDGLRSVFWHTFCDDYLEIAKHRIR-----------------EGTTGDA
205|gene|hut        EKLDTYEFSKARNELRTFFWSTFCDDYLEIAKQR-----------------------DDK
2261|gene|hhi       TKFEDYEFSKARNELRSFFWNTFCDDYLEIAKQRLSGEARSASEQSSGQGPRDDG--EDA
11729|gene|hma      AKFEDYEFSKARNELRSFFWNTFCDDYLEIAKQRLS-----------------DG--EAV
                      ::   *****: **:.** *********.*:*                          

18|gene|hla         AAAYTLRTAHRRFLKLFAPLLAHVTEELWHDMYADGASDPDAVDAAVADGARDSIHLADW
3120|gene|hbo       SAKYTLRTAHRRFLKLFAPILAHVTEELWREMH-----------------EETSVHRASW
1051|gene|hwa       AAAYTLTVAHRRFLKLFAPILAHASEELWHDMYVSNSIDK------TDDISSESIHRQSW
205|gene|hut        SAAYTLVTAHRTFLKLFAPFLPHVVEEIWQAKY-------------AEVGERNSIHVSEW
2261|gene|hhi       STEFTLLQAHRTFLQLFAPFLPHITEELWERCY----------------EEDSSIHTTDW
11729|gene|hma      STEFTLLQAHRTFLQLFAPFLPHITEELWERCY----------------EEDSSIHTTDW
                    :: :**  *** **:****:*.*  **:*   :                    *:*  .*

18|gene|hla         PEPLGLEADHEAGAAATAVVGALRKYKSKNQLPLNAELDAVEVYADVRGFEEDITGVMHV
3120|gene|hbo       PEPLGLEADFEAGETAMAVVGALRKYKSDNQLSMNAPIDLVQVYGDVQDFEADISGVMHV
1051|gene|hwa       PNPLGIDANVDAGEAAMSVVGALRKYKSNAQLPMNATLDRVLIWGDIDGFESDIADVMHI
205|gene|hut        PEPRGYDADLAAGETAMATIGALRGYKTDHGMALNADIDRVEVYGDVSGFESAIQQAMHV
2261|gene|hhi       PTAGGYDADLEAGETAMEVVSALRRYKTENGLPLNADLDHVEVFGHIAGFEDAVAEAMHV
11729|gene|hma      PTSGGYDADLEAGETAMEVVSALRRYKTENGLPLNADLDHVEVFGHIAGFEDAVAEAMHV
                    * . * :*:  ** :*  .:.*** **:.  :.:** :* * ::. : .**  :  .**:

18|gene|hla         ADLTVHPDEDAPVETVITGIDLDYATVGPKYGDQVGDIEAALAKEEYEIDGEELHVTGVT
3120|gene|hbo       EEMETL-AEEPQIESVVTGVDLDYSLVGPEFGAQVPDIEAALEAEEYEVGDGHLHAAGVE
1051|gene|hwa       ETLESV-SERPSIESVVTGVDLEYSLVGPAFGNAVSDIETAIESGEYEVVDDQLHTEGIT
205|gene|hut        DELSVV-EDDPEISTEIAEISLDYATVGPKYGDQVGGIEQAIATDEYELDGDRLHAGDVT
2261|gene|hhi       TQLDTY-DEAPDITTEVSGIDLDYSIVGPEFGSEVGSIDDAIESGDYEIDGDTLRVAGVE
11729|gene|hma      AQLDTY-DEAPDITTEISGIDLDYSLVGPEFGSEVGAIDAAIEDGDYEIDGDTLQVAGVE
                      :     : . : : :: :.*:*: *** :*  *  *: *:   :**: .  *.. .: 

18|gene|hla         LVEEEFAIEEERQYQGDGEL--LEADDVVVIVRNEA
3120|gene|hbo       LAPEMFTIEEERKYMGDGEM--LEAGDAVVIVQHEN
1051|gene|hwa       LDPEMFDIQKRRQYTGDGEMLDLDTDDVIVIVQNN-
205|gene|hut        LEPDEFEVRKEHTYAGEGEL--VETDDVAIVVQS--
2261|gene|hhi       LDDEMFAVEESRTYSGEGEM--TETESAVVVVR---
11729|gene|hma      LDDEMFAVEESRTYSGEGEM--TETESAVVVVR---
                    *  : * : : . * *:**:   :: .. ::*.