HOG Organism Gene ID Name Annotation
aHOG1295 hhi 389 kdgA 2-dehydro-3-deoxyphosphogluconate aldolase/4- hydroxy-2-oxoglutarate aldolase
aHOG1295 hbo HBOR21830 Hbor_21830 2-keto-3-deoxy-phosphogluconate aldolase( EC:4.1.3.16,EC:4.1.2.14 )
aHOG1295 hla HLAC0151 Hlac_151 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
aHOG1295 hla HLAC2860 Hlac_2860 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
aHOG1295 hmu HMUK1228 Hmuk_1228 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase( EC:4.1.2.14,EC:4.1.3.16 )
aHOG1295 hut HUTA1331 Huta_1331 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
aHOG1295 hwa HQ1495 eda KHG/KDPG aldolase (4-hydroxy-2-oxoglutarate aldolase; 2-dehydro-3-deoxy-phosphogluconate aldolase)
aHOG1295 hma Hma_13121 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase
MUSCLE (3.6) multiple sequence alignment


2860|gene|hla       ------------------------------------------------------------
389|gene|hhi        ------------------------------------------------------------
13121|gene|hma      MSSHQQWSPSERFRSSSGCSPDAPAWSRFCPPTPPPTIWAITRSTPSRCRKLRTTPVTGA
1331|gene|hut       ------------------------------------------------------------
151|gene|hla        ------------------------------------------------------------
21830|gene|hbo      ------------------------------------------------------------
1495|gene|hwa       ------------------------------------------------------------
                                                                                

2860|gene|hla       ------------------------------------------------------------
389|gene|hhi        ------------------------------------------------------------
13121|gene|hma      ASPTPPNSTHSTRLPTRWHPAKTSRGPTTTTRRARNCSTCSKARFTSKRPTGSTSSRPTR
1331|gene|hut       ------------------------------------------------------------
151|gene|hla        ------------------------------------------------------------
21830|gene|hbo      ------------------------------------------------------------
1495|gene|hwa       ------------------------------------------------------------
                                                                                

2860|gene|hla       ------------------------------------------------------------
389|gene|hhi        ------------------------------------------------------------
13121|gene|hma      CLSPNRTARTTRTTPPMPTNQSLCLASAHRRPTSRARTTLTRNERSGGSDTLFSHPVTVA
1331|gene|hut       ------------------------------------------------------------
151|gene|hla        ------------------------------------------------------------
21830|gene|hbo      -----------------------------------------------------------M
1495|gene|hwa       ------------------------------------------------------------
                                                                                

2860|gene|hla       ---MRTDRLDRITDGGVIAILRGVNTADAVAVADAVVDAGVTALEITADTPNSMSSIEAI
389|gene|hhi        -MTSKQAVQQELVDSGVTAVLRGIPEEKMVDVATAVHEGGVTALELTADAKRCSDMIAAV
13121|gene|hma      PMTSKQAVQQELVDSGVTAVLRGIPEEKMVDVATAVHEGGVTALELTADAKRCSDMIAAV
1331|gene|hut       ----MSDIEQQFVDSGVVAVLRNIDADAMVDTVEALHRGGVTAFEVTVDARNASELVGDV
151|gene|hla        ----MNETLSRLVDSGVVAVLRGVEADQLIEITEALRDGGVTAVEITADTPNVAEKLSEV
21830|gene|hbo      VTLDSHEDMQRLVDSGVVAVMRGADADTILEVAQALHDGGVTAYEITADNPDAMDLISEV
1495|gene|hwa       MTTNISRVFDQLIDSGVVAVMRGADADTIIDVATALHDGGVTAYEITADNANAAALINEV
                             . : *.** *::*.      :  . *:  .**** *:*.*       :  :

2860|gene|hla       SDRVD--DALVGAGTVLDAETARAAQLAGAEFLVTPTVNRNVIRTANRYGTPIAVGAYTP
389|gene|hhi        DKALDDTDAIIGAGTVMDAAAARNVIEAGAEFVLAPNLNEDVIDVCNREGVLAIPGVMTP
13121|gene|hma      DKALDDTDAIIGAGTVMDAAAARNVIEAGAEFVLAPNLNEDVIDVCNREGVLAIPGVMTP
1331|gene|hut       VETFDGEDAVVGAGSVLDAAAARSAIEAGAEFVVGPTLEEDVIETANRYDTLVAPGVMTP
151|gene|hla        AGSFDD-EVVVGTGTVLDSETARTTLMAGAEFVVSPSLHEDVIETCNRYGAVSAPGVMTP
21830|gene|hbo      SASFSETEAIVGAGTVLDSETARASIMNGAEFVVGPSFDEGVVETCNRYGTIVAPGILTP
1495|gene|hwa       HASFRDSEVIVGAGTVLDSPTAQEMITSGAEFIVGPTFDPDILEICNRHGTLVAPGILSP
                       .   :.::*:*:*:*: :*.     ****:: *..  .::  .** ..    *  :*

2860|gene|hla       TEALEAYQAGADAVKVFPAKTGGPDHVAAIGGPLPQIPLVPTGGVSAENAGAYVRAGAVA
389|gene|hhi        TEAADAMEAGADILKMFPAKTVGPAHIGALQGPLGDVPIMPTGGVSTDNVDEFFDAGAVA
13121|gene|hma      TEAADAMEAGADILKMFPAKTVGPAHIGALQGPLGDVPIMPTGGVSTDNVDEFFDAGAVA
1331|gene|hut       TEALRAAEAGADLIKVFPAATVGPGHLSAIQAPLGDLPLMPTGGVGPDNVADFFEAGATV
151|gene|hla        TEAIRGYEAGADFVKVFPAKTVGPAHLGAMKGPLGQIPMMPTGGVGPDNAADYIDAGAFA
21830|gene|hbo      TEAVDAYEAGADLVKVFPASVMGPKHLASIKGPLPQIPLMPTGGIGIDNVADYIEAGAVV
1495|gene|hwa       TEALNAYEAGADLLKVFPAATVGPTHLSSIAGPLPHLPLMPTGGINIDNVADYIEAGAAV
                    ***  . :**** :*:*** . ** *:.:: .**  :*::****:. :*.  :. *** .

2860|gene|hla       VGVGGSIVDHEAIDDDAYDQVEANARAVVEAVSAARD-------
389|gene|hhi        VGAGSALVNYEAIENDDMDGVREQAAAFVDAVEAARE-------
13121|gene|hma      VGAGSALVNYEAIENDDMDGVREQAAAFVDAVEAARE-------
1331|gene|hut       VGAGSALIDYDAIERGDFEAVEAHAGEFVAAVEDARE-------
151|gene|hla        VGAGGALVDYDAAARGDYESITETARQFVQVVEDARGDD-----
21830|gene|hbo      VGAGSAIMDADAIEAGDFEAITETAREFTQVIEDARE-------
1495|gene|hwa       VGAGGALMNTDAIAAGDFESITETAEMFTQEIETARMRNSSSSS
                    **.*.:::: :*   .  : :   *  ..  :. **