HOG Organism Gene ID Name Annotation
aHOG1294 hhi 1608 HAH_1608 hypothetical protein
aHOG1294 hbo HBOR14040 Hbor_14040 uncharacterized conserved protein
aHOG1294 hla HLAC1617 Hlac_1617 hypothetical protein
aHOG1294 hmu HMUK2197 Hmuk_2197 conserved hypothetical protein
aHOG1294 hut HUTA2932 Huta_2932 conserved hypothetical protein
aHOG1294 hwa HQ1796 hypothetical protein
aHOG1294 nrc1 VNG1514 vng1514 no entry
MUSCLE (3.6) multiple sequence alignment


1514|hp|nrc1      MTTWVE-PEGGRERGPLGLAKSFTQVLLNPVSFFDEAVSPGDQAPGLVFAMVVVGVVAAT
1608|hp|hhi       -------------------MRAWVEILRRPRRFFRTGVAPGDQAPGLVFAATVVLFEEVS
2932|chp|hut      ----------------MGLLRAWLGVMTTPREFFQNAVAPGDQAPGLVFLTGIVAIEESV
1617|hp|hla       MTSWIADPEGGRARGPRALARAWIEALVRPRRLFANGVAPGDQAPALTFAVAVAAAYALG
14040|hp|hbo      MTTWIEHPEGGRERGPRGVARAWFEVLTRPQRFFRNGVSPGDQAPGLVFAVVVAVAYTTV
1796|hp|hwa       MTTWVETPTGGRERGPRGVVRAWIAVIIAPRQFFASAVTPGDQAPGLVFAISIATAYVVG
                                      .::   :  *  :*  .*:******.*.*   :.      

1514|hp|nrc1      ELAAT-----------PSDALAFPTADWLAAVLTVALVVLLVTPAAVHALSAIQTLCLVI
1608|hp|hhi       RYAVVKLAQRGLLSTGPFDYPAIGGFSPGVAVLALFAILVFVTPATVHLTAALQTLLLLP
2932|chp|hut      RYALV-----------PGAAPVLSDRPVATAVLAVLVTVVLIAPTGLHLLAAIQTILLWP
1617|hp|hla       WIVSE-----------PGVVPEIVVSVPVSAAILFLLVVVLVAPVGLHLTAAVATLSVIL
14040|hp|hbo      LFAFV-----------PARIPALAGGQALSAFVGLAAVALLLAPAVLHITAALQTVFLIA
1796|hp|hwa       LFAGN-----------PSQIPQLSNNLMTSASITVLAVVLLIAPAILHLTAAVQTIVLIF
                    .             *     :       * : .    ::::*. :*  :*: *: :  

1514|hp|nrc1      A-------TISESRGGVSETVQLIAYAAAPCVVTGLGVPVLTLLAGVWAWCLLVVGTSVV
1608|hp|hhi       LGLL----PVASDRGGVSETVQVMCYAMAPCLLAGLPSAEVRVLVTAWGAGLYLLGTAVV
2932|chp|hut      ---------ITEDRAGISETVQVLAYATAPCVVAGIPWPPLQVAATGYGSLLLVAGLSTV
1617|hp|hla       ASVEFDDGIALRDRGGVSETVQVVAYASSPMALAGPPIPELRVVCGAYAAVLLLIGFRIV
14040|hp|hbo      --------TVWENRGGISETVQVIAYASAPCAVAGIPSPELRLVCAGYGAVLMFIGLSEV
1796|hp|hwa       ---------VVPDRAGVSETVQIVAYAAAPCIIAGIPIAALQVVCAIYASILLIIGIREV
                              .*.*:*****::.** :*  ::*   . : :    :.  * . *   *

1514|hp|nrc1      HEISLPRAVIAAAVPGVLAFGAGFGAIPAGEQVIHAAGLAF
1608|hp|hhi       HNIRHPVAAIVGAVPAAIIFGYGFRGFQAVSVLAADYGF--
2932|chp|hut      HGINQLKGMLAGAIPAALLYGVAFGGFDAVGAIV-------
1617|hp|hla       HGTTLLRTLVAGVPPALLGYGVGYRVFAAVRTLIG------
14040|hp|hbo      HDVSIAHAAVAGAVPATFLFGYVFGGATAFITIVRTLGVI-
1796|hp|hwa       HTTSTLRAVIAAGIPATLLYGSALGGIDAGVELLQSLSIL-
                  *        :..  *. : :*       *   :