HOG Organism Gene ID Name Annotation
aHOG1293 hhi 962 HAH_0962 hypothetical protein
aHOG1293 hbo HBOR37530 Hbor_37530 hypothetical protein
aHOG1293 hla HLAC0734 Hlac_734 hypothetical protein
aHOG1293 hmu HMUK2100 Hmuk_2100 conserved hypothetical protein
aHOG1293 hut HUTA0849 Huta_0849 conserved hypothetical protein
aHOG1293 hwa HQ1718 hypothetical protein
aHOG1293 hwa HQ2421 hypothetical protein
aHOG1293 nrc1 VNG1314 vng1314 no entry
aHOG1293 hma Hma_10216 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


37530|hp|hbo      MDRGVVTIDDTESHRELLCEAAEHAESADAELLLLRFLDEKTYEQEIETLETIGNIENVN
2421|hp|hwa       -----------MVLIDIVQESSAYIHTKRIPTPVFPCGRIETCMSANDDTP---VEQTNN
962|hp|hhi        -------------------------------------------MSESET-P----METTT
10216|hp|hma      ---------------------------------------MVYCMSESET-P----METTT
1314|hp|nrc1      -------------------------------------------MSETDS-ASETVEEPTT
849|chp|hut       ------------------------------------------MMSESDTGAENTIEETTN
734|hp|hla        -----------------------------------MLRTLLPAMSDAEA-PEERIDDTTT
1718|hp|hwa       -------------------------------------------MSEMDV-PEERIQETTS
                                                              .  :        :  .

37530|hp|hbo      YTADEVTEAVTANTRELAEVVLEEFDVDFNVAVSVTSDKRRADRLIETGAAHDCDHAFIV
2421|hp|hwa       W----------------PELVAMVYEEMSGGDGSTTLRLRNMEIQVPSKTGPDADHAH--
962|hp|hhi        W----------------PELAIGLYDRLTGRNAEITYDFDDMEVDVPSKAGEDAEHAR--
10216|hp|hma      W----------------PDLAIGLYDRLTGRNAEITYDFDDMEVDVPSKAGEDAEHAR--
1314|hp|nrc1      W----------------PDLAVGLYDRLTGRGAEIIYEFDELDVDVPSGTGDDAEHAR--
849|chp|hut       W----------------PELAVGLYDRLTGRGAEIVYDFEDLDVAVPSKVGEDAEHAH--
734|hp|hla        W----------------PDLAIGLYDRLTGRNAEIIYEFEDMTVDVPSGTGDDAEHAH--
1718|hp|hwa       W----------------PDLAISLYDRLTGRGAEIIYDFEDMEVEVPSGTGEDAEHAQ--
                  :                .::.   ::   .   .           : : .. *.:**   

37530|hp|hbo      GESRSPTGKALFGDFAQNVILNFGGYVTVTFDKRQ
2421|hp|hwa       --------------------WTVDGTIDLNPEE--
962|hp|hhi        --------------------WRVDGTLTITTRDND
10216|hp|hma      --------------------WRVDGTLTITTRDND
1314|hp|nrc1      --------------------WHVDGTIRVTTRERD
849|chp|hut       --------------------WHVDGTVRVTTNERE
734|hp|hla        --------------------WRLDGTMRITTREQD
1718|hp|hwa       --------------------WRLDGTVRVTTRERE
                                        ..* : :.  .