HOG Organism Gene ID Name Annotation
aHOG1292 hhi 5279 adh7 alcohol dehydrogenase
aHOG1292 hla HLAC0215 Hlac_215 Alcohol dehydrogenase GroES domain protein
aHOG1292 hmu HMUK2438 Hmuk_2438 Alcohol dehydrogenase GroES domain protein( EC:1.1.1.1 )
aHOG1292 hut HUTA1854 Huta_1854 Alcohol dehydrogenase GroES domain protein
aHOG1292 hwa HQ1124 adh alcohol dehydrogenase
aHOG1292 nrc1 VNG2617 tdh2 Threonine dehydrogenase and related Zn-dependent dehydrogenases
aHOG1292 hma Hma_7278 adh12 alcohol dehydrogenase
MUSCLE (3.6) multiple sequence alignment


1124|gene|hwa       --------------------------------------MSAAVYYGPRDIRVENVVKPTL
215|gene|hla        --------------------------------------MRAAIFNGPGDIGVEERPRPEI
2617|gene|nrc1      --------------------------------------MRAAVYQGPGEIAVEEVPKPDI
1854|gene|hut       ------------------------------------MDMRAAVFRGPGEIAIEDVPKPAL
5279|gene|hhi       --------------------------------------MRAAIYRGPGEIAVEEVPRPEI
7278|gene|hma       MFLYLYSIFGNCFHPITRPGGCDRRHENGFPQPTRNGSMRAAIYRGPGDITVEEVPRPEI
                                                          * **:: ** :* :*:  .* :

1124|gene|hwa       EESTDAVVRVTHTAVCGSDLWFYRGKTDRDIPSRVGHEPMGIVEEVGDDVQSVDVGDRVF
215|gene|hla        EAPTDAIVRVTHTAICGSDLWFYRGDSDRDEGSPVGHEPMGIVEEVGNEVTSVAPGDRVL
2617|gene|nrc1      ESPEDAVIRVTHTAVCGSDLWFYRGDSDREAGSRVGHEPMGIVEEVGDDVTSVAPGDRVI
1854|gene|hut       DAPTDAVVRVTHTAICGSDLWPYRGQEDRDVPSRIGHEPMGIVEEVGEEVRSVAPGDRVF
5279|gene|hhi       ESPTDAIVRVTHTAVCGSDLWFYRGQSDREEGSRVGHEPMGIVEEVGDDVRSVEPGDRVF
7278|gene|hma       ESPTDAIVRVTHTAVCGSDLWFYRGQSDREEGSRVGHEPMGIVEEVGDDVRSVEPGDRVF
                    : . **::******:****** ***. **:  * :************::* **  ****:

1124|gene|hwa       APFKISCGMCEFCRRGLHTSCVNGDGWGDD-NGGAQGEVIRCRHADGTLVRVPDAYANDD
215|gene|hla        APFAISCGECEFCRKGLHTSCENGDSWGGD-NGGGQGEYVRSTHADGTLVRVPDRFADDE
2617|gene|nrc1      APFAISCGECEFCRQGLYTSCVEDESWGSEANGGGQGEYVKCPFADGTLVRVPDRYADDE
1854|gene|hut       APFVTSCGECEFCRKGLHTSCVNGGFWGGE-DGGAQGEYVRARHADGTLVRVPDRHADDE
5279|gene|hhi       APFVISCGRCEFCRKGLHTSCVNGDSWGGD-NGGGQGEYVRATEADGTLVRVPDRHADDE
7278|gene|hma       APFVVSCGRCEFCRKGLHTSCVNGDSWGGD-NGGGQGEYVRATEADGTLVRVPDRHADDE
                    ***  *** *****.**:*** :.  **.: :**.*** :..  ********** .*:*:

1124|gene|hwa       SALRSILPLTDVMGTGHHAAVSAGVSAGSTCVVVGDGAVGLCGVLAARRLGAARIVAVGH
215|gene|hla        ETLRSLLPLTDVMGTGHHAAVNAGVEAGSTVVVIGDGAVGLCGVLAARRLGAERIIAVGH
2617|gene|nrc1      DVLESLLPLTDVMGTGHHAAVSAGVGEGDTAVVVGDGAVGLCGVLAAQRLGAERIIAMGH
1854|gene|hut       ETLQAILPLTDVMGTGHHAAVSAGVDAGSTCIVVGDGAVGLCGVLAARRLGAERIIAMGH
5279|gene|hhi       DTLEAILPLTDVMGTGHHAAVSAGVSEGDSCIVVGDGAVGLCGVLAARRLGAERIIAMGH
7278|gene|hma       DTLEAILPLTDVMGTGHHAAVSAGVSEGDTCIVVGDGAVGLCGVLAARRLGAERIIAMGH
                    ..* ::***************.***  *.: :*:*************.**** **:*:**

1124|gene|hwa       HPDRLSLASEFGATDTVSARGQEAIETVQEMTGGGAEHVLECVGATSAMETAVEVCRPGG
215|gene|hla        HEDRLELAEEFGATETVSERGEAAVERIQELTHGGPNHVMECVGAASAMNTAIDVVRPGG
2617|gene|nrc1      HEDRLELAAEFGATDTISARGDDAIERARDLTHGGANHVMECVGAASAMDSAIAIARPGG
1854|gene|hut       HEDRLALAESFGATDTIAARGEEAVERAQELTYGGANHVMECVGSTGAMNTAIEVCRPGG
5279|gene|hhi       HEDRLELAESFGATETIAARGQDAVDAADDLTNGGANHVLECVGAASAMETAIDVCRPGG
7278|gene|hma       HEDRLELAESFGATETVAARGQDAVDAADDLTNGGANHVLECVGAASAMETAIDVCRPGG
                    * *** ** .****:*:: **: *::   ::* **.:**:****::.**::*: : ****

1124|gene|hwa       TVGYVGVPHGLDD-GLDLFSFFGDNITLQGGVAPVRAYADELLADVLQGTLDPAPVFTKT
215|gene|hla        TIGYVGVPYGVEEEGLNVFGMFGDNVTLAGGVAPVRAYAEELMADVLQGTLDPAPVFTET
2617|gene|nrc1      TVGYVGVPYGVEDGGLDVFTMFSDNITIRGGVAPVRAYAEELMADVLQGTLDPSPIFTKT
1854|gene|hut       TVGYVGVPHGIEDDGLDIFGLFMDNISLNGGIAPVRAYADELLADVLGGTLDPSPIFTKT
5279|gene|hhi       TVGYVGVPHGVDDSGLDVFSLFGDNIALNGGVAPVRAYADELLADVLQGTLDPSPIFTKT
7278|gene|hma       TVGYVGVPHGLDDSGLDMFSLFGDNIGLNGGIAPVRAYADELLADVLQGTLDPSPIFTKT
                    *:******:*::: **::* :* **: : **:*******:**:**** *****:*:**:*

1124|gene|hwa       VDLDSISEGYQAMDERDAIKVLVEI
215|gene|hla        VGLDEVDEGYRMMDEREAIKVLVKL
2617|gene|nrc1      VDLDGVPEGYAAMDDREAIKVLVKA
1854|gene|hut       VDLDGVPEGYRAMDEREAIKVLVKP
5279|gene|hhi       VDLDGVPEGYRAMDEREAIKVLVKL
7278|gene|hma       VDLNGVPEGYQAMDEREAIKVLVKL
                    *.*: : ***  **:*:******: