HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0129COG0520KOG1549arCOG00065Selenocysteine lyaseNifS protein.class-V aminotransferase

HOG Organism Gene ID Name Annotation
cHOG0129 nrc1 VNG2471 nifS NifS protein.class-V aminotransferase
cHOG0129 hmu HMUK1242 Hmuk_1242 cysteine desulfurase, SufS subfamily( EC:4.4.1.16,EC:2.8.1.7 )
cHOG0129 hma RRNAC3104 csd1 cysteine desulfurase
cHOG0129 hwa HQ3427A nifS cysteine desulfurase, class V aminotransferase
cHOG0129 hla HLAC2248 Hlac_2248 cysteine desulfurase, SufS subfamily
cHOG0129 hbo HBOR01140 Hbor_01140 cysteine desulfurase( EC:2.8.1.7,EC:4.4.1.16 )
cHOG0129 hbo HBOR34450b Hbor_34450 cysteine desulfurase( EC:4.4.1.16,EC:2.8.1.7 )
cHOG0129 hut HUTA1228 Huta_1228 cysteine desulfurase, SufS subfamily
cHOG0129 hvo HVO_0109 HVO_0109 csd aminotransferase class V superfamily
cHOG0129 nph NP0936A nifS cysteine desulfurase, class V aminotransferase
cHOG0129 hhi 356 nifS1 cysteine desulfurase
MUSCLE (3.6) multiple sequence alignment


34450|gene|hbo      --------MHEDIAAIRDDFPILSRSVGDE------------QLVYLDNAATTQTPEQVY
2471|gene|nrc1      MEATEQ--GPIDVEAVRADFPILEREVAGG-----------EDLVYLDNAATSHTPEPVV
2248|gene|hla       MGVQEQ--YPFDVEAVRADFPILDRLVGGDPESPGEGPGDDTPLVYLDSAATSQTPDPVV
1228|gene|hut       MTARET--GDLDVSAIREDFPILEREFDGT------------PLVYLDNAATTQTPQRVI
936|gene|nph        -MSQQA--EPLNVEAIREDFPILQREFDDT------------QLVYLDNAATTQTPEPVV
13104|gene|hma      MGHAES--EVLDVERLREDFPILQREFGGE------------QVVYLDNAATTQTPEPVV
356|gene|hhi        MGHAES--ELLDVERIREDFPILQREFDGE------------QVVYLDNAATTQTPEPVV
3427|gene|hwa       MGTQEQKAYPIDIPSVRGDFPILDRKVGGNIETPGPSPDDTDPLIYLDNAATSQTPTDVV
1140|gene|hbo       MGVQES--YPIDVATIREDFPILDRKVGGDFTVPGEGDGDSLPLVYLDNAATTQTPKQVV
                               ::  :* *****.* . .              ::***.***::**  * 

34450|gene|hbo      DVFEEFYAGYNANVHRGIHTLSHEASVAYEEAHDRLAEFIGASGGREELIFTKNTTESIN
2471|gene|nrc1      DAIADYYRRYNSNVHRGLHELSQEASVAYEDAHDKLAAFVGGED-REEMVFTKNTTEAEN
2248|gene|hla       DTIVDYYRGYNANVHRGIHQLSQEASVAYEEAHDTVADFIGASG-REEIVFTKNTTEAMN
1228|gene|hut       DAISEYYETYNANVHRGLHHLSQEASVAYEEAHDRMAEFIGASGGREELIFTGNTTESEN
936|gene|nph        ETIADYYRRYNANVHRGIHQLSQEASIAYEEAHDRVAEFIGASGGREEVIFTKNTTESVN
13104|gene|hma      ETIADYYRTTNANVHRGLHQLSQEASVAYEDAHDRVAEFIGASGEREEIVFTKNTTESEN
356|gene|hhi        ETIADYYRTTNANVHRGLHQLSQEASVAYEKAHDRVAEFIGASGEREEIVFTKNTTESEN
3427|gene|hwa       DALTEYYYQYNSNVHRGIHHLSQEASVAYEVAHDRVAEFIGADG-REEIIFTKNTTESMN
1140|gene|hbo       DAIVEYYYGYNSNVHRGIHHLSQEASVAYENAHDRVAEFIGASG-REEIVFTKNTTEAMN
                    :.: ::*   *:*****:* **:***:*** *** :* *:*... ***::** ****: *

34450|gene|hbo      LVAYGVGLNELGPGDNVVTTEMEHHASLVTWQQVAKRTGADVRFIRVDDDGKLDLEHAAE
2471|gene|nrc1      LVAFAWGLNELGPGDEVVLTQMEHHASLVTWQQVADETGAEVKYIPITDDGHLDMDAAAD
2248|gene|hla       LVAYAWGLEELGPGDNVVLSQMEHHASLVTWQQIGKRTGADVRFIEVTDEGRLDMEHAAE
1228|gene|hut       LVAYAWGLNELGPGDEVVLTEMEHHASLVTWQQIAKRTGATVRYIRVDEDGHLDMDHATE
936|gene|nph        LVAYAWGLEELGPGDEIVLTEMEHHANLVTWQQIAKRTGAECKYIPITDEGRLDMDAARE
13104|gene|hma      LVAYAWGLNELGPEDEVVLTEMEHHASLVTWQQIAKKTGATCRYIRVDEDGTLDMDHARE
356|gene|hhi        LVAYAWGLNELGPEDEVVLTEMEHHASLVTWQQIAKKTGATCRYISVDEDGTLDMDHARE
3427|gene|hwa       LVAYAWGLAELEPGDTVVLSEMEHHASLVTWQQIAKRTGANVEYIRVDEDGYLDMEHARE
1140|gene|hbo       LVAYAWGLEELEPGDKVVLTEMEHHASLVTWQQIAKKTGASVEYIRVDEDGRLDMDHAAD
                    ***:. ** ** * * :* ::*****.******:.. ***   :* : ::* **:: * :

34450|gene|hbo      LIDNDTQLMSIVHVSNVLGTVNPVEELTELAHEQDALVFIDGAQAVPNRRVDVEEIDADF
2471|gene|nrc1      MITDDTALVNAVHISNTLGTVNPVGELADIAHDHGAYIFVDGAQAAPTRAVDVQEIDADF
2248|gene|hla       LIDDDTQMVSVVHVSNTLGTINPISELADLAHDHDAYVFADGAQSVPTRPVDVDDLGVDF
1228|gene|hut       LIGPDTAMVSVVHVSNTLGTINPVAELADLAHAEDAFIFVDGAQAVPNRPVDVEAIDADF
936|gene|nph        LITDETEMVAAVHVSNTLGTVNPVSELAAIAHDHDAYMFVDAAQSVPNRSVDVEAIDADF
13104|gene|hma      IITDDTAMVSVVHVSNTLGTVNPVSELADIAHDHDSYIFVDGAQSVPNRPVDVEAIDADF
356|gene|hhi        IITDDTAMVSVVHVSNTLGTVNPVSELADIAHDHGSYIFVDGAQSVPNRPVDVEAIDADF
3427|gene|hwa       LIDDSIAMVSVVHISNTLGTVTPVEELAELTHDHGGYIFIDGAQSAPTRPVDVDAMDTDF
1140|gene|hbo       LIDEDTKMVSVVHISNTLGTVNPVSELADMAHEVGSYIFVDGAQSVPTRPVDVTDIDADF
                    :*  .  ::  **:**.***:.*: **: ::*  .. :* *.**:.*.* ***  :..**

34450|gene|hbo      YAFSGHKMAGPTGVGCLYGKHHLLESMEPFLYGGEMIRHVTYEDSTWNRPPWKFEAGTPP
2471|gene|nrc1      YAFSGHKMLGPTGIGCLYGKRHLLAEMEPFLYGGDMIERVSYEDATWNDPPWKFEAGTPV
2248|gene|hla       LAFSGHKMCGPTGIGALYGREEILDEVQPYLYGGDMIRRVSFTDSTWEDLPWKFEAGTPS
1228|gene|hut       YAFSGHKMAGPTGIGALYGKQAILEHMEPFNYGGDMITKVTYEDATWNELPWKFEAGTPK
936|gene|nph        LAFSGHKMCGPTGIGVLYGKQHILESMEPYLYGGEMILKVTFEDSKWNELPWKYEAGTPV
13104|gene|hma      LAFSGHKMAGPTGIGVLYGKKHILEEMEPYLYGGEMIKKVTFEDASWNDLPWKFEAGTPV
356|gene|hhi        LAFSGHKMAGPTGIGVLYGKKHLLEEMEPYLYGGEMIKKVTFEDATWNDLPWKFEAGTPV
3427|gene|hwa       FAFSGHKMLGPTGIGVLYGKQEILESMEPYLYGGEMIRRVTYEDSTWEDLPWKFEAGTPV
1140|gene|hbo       FAFSGHKMLGPTGIGVLYGKEEILEEMTPYLYGGEMIRRVTYDDSTWEDLPWKFEAGTPV
                     ******* ****:* ***.  :*  : *: ***:** .*:: *:.*:  ***:***** 

34450|gene|hbo      IAEGIALAAAADYLDDVGMDFVEERENELAQYALERLTERDDVEVYGPPLGEARSGLVAF
2471|gene|nrc1      IAQGIALAEAVDYLQDIGMDAIRAHEEALTEYAYDQLTMTDDVDVYGPP-GDDRGAVVSF
2248|gene|hla       IAQGIAFAAAIEYLEEIGMQNVQAHEDLLAEYAYDELTDLGGVEIYGPP-GNDRGGLVAF
1228|gene|hut       IAQGIALAEAADYLDEIGLDAIARHENELAQYAIDRLSEFDDIEIYGPSAGEERGGLVSF
936|gene|nph        ISQGIALAEACDYLDDIGMDRIERHEARLAEYAYDRLTEHDDVEVYGPP-GDDRGGLVAF
13104|gene|hma      IAQGIALAEACDYLDNIGMERIQRHEEQLAQYTLEQLREEGDVETYGPSVGTERGGLVSF
356|gene|hhi        ICQGIALAEACDYLDDIGMERIQRHEEQLAQYALEQLRDEGDVETYGPSAGTERGGLVAF
3427|gene|hwa       IAQAIGLHAAIDYLEDIGMETVQAHEELLAEYAYNQLSAFDDVETYGPP-GGDRGGLVAF
1140|gene|hbo       IEQGIALHAAIDYLDEIGMENVQAHEERLAAYAYDRLAEFDDIEIYGPP-GDERGGLVAF
                    * :.*.:  * :**:::*:: :  .*  *: *: : *   ..:: ***. *  *..:*:*

34450|gene|hbo      NLDGVHGHDLSALLDERGIAVRAGDHCTQPLHDRLDIPGSVRASFYVYNTTDEIDQLLDA
2471|gene|nrc1      NVDGIHAHDLSSILNDYGVAIRAGDHCTQPLHDTLGVPASARASFYLYNTRDEVDALVAA
2248|gene|hla       NVEGVHAHDLSSILNDYGVAIRAGDHCTQPLHDELGVAASARASFYLYNTVEEIDALVEA
1228|gene|hut       NLESVHAHDLSSILNDYAVAIRAGDHCTQPLHDKLGVAASARASFYLYNTRDEIDVLIDA
936|gene|nph        NVDSVHAHDLSSILNDSAVAIRAGDHCTQPLHDVLGATASARASFYIYNTKTEVDKLVEA
13104|gene|hma      NLDSVHAHDLSSILNDSAVAIRAGDHCTQPLHDKMGVPASARASFYIYNTREEVDKLVSA
356|gene|hhi        NLDSVHAHDLSSILNDSAVAIRAGDHCTQPLHDKMGVPASARASFYIYNTREEVDKLVSA
3427|gene|hwa       NLEGVHAHDLSSILNEYGVAIRAGDHCTQPLHDKIGVPASTRASFYIYNTREEIDELVTA
1140|gene|hbo       NLDGVHAHDLSSILNDHAVAVRAGDHCTQPLHDKLDIAASTRASFYVYNTYDEVDKLIEA
                    *::.:*.****::*:: .:*:************ :. ..*.*****:***  *:* *: *

34450|gene|hbo      LDVARDELDSHLASEQYHDLVYEHYRNPQNTGGLSNPTFTKHSEETSCGDDGEFHVDVAE
2471|gene|nrc1      VDEARQIFAP--------------------------------------------------
2248|gene|hla       VGEARDLFA---------------------------------------------------
1228|gene|hut       IDDARQLFG---------------------------------------------------
936|gene|nph        VDDARQLFS---------------------------------------------------
13104|gene|hma      IDDARQLFA---------------------------------------------------
356|gene|hhi        IDDARQLFA---------------------------------------------------
3427|gene|hwa       VDAARELFA---------------------------------------------------
1140|gene|hbo       VDDARTLFA---------------------------------------------------
                    :. **  :                                                    

34450|gene|hbo      DGTIENIAFESESCAVSSAVASMLSERLEGMSLEEVAELDGFVDEVLDGTYPDIRRDCVV
2471|gene|nrc1      ------------------------------------------------------------
2248|gene|hla       ------------------------------------------------------------
1228|gene|hut       ------------------------------------------------------------
936|gene|nph        ------------------------------------------------------------
13104|gene|hma      ------------------------------------------------------------
356|gene|hhi        ------------------------------------------------------------
3427|gene|hwa       ------------------------------------------------------------
1140|gene|hbo       ------------------------------------------------------------
                                                                                

34450|gene|hbo      GPEEVICEAAREQMDGSNGRAVL
2471|gene|nrc1      -----------------------
2248|gene|hla       -----------------------
1228|gene|hut       -----------------------
936|gene|nph        -----------------------
13104|gene|hma      -----------------------
356|gene|hhi        -----------------------
3427|gene|hwa       -----------------------
1140|gene|hbo       -----------------------