HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0128COG0694KOG2358arCOG03026Thioredoxin-like proteins and domainshypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0128 nrc1 VNG2337 vng2337 no entry
cHOG0128 hmu HMUK0908 Hmuk_0908 nitrogen-fixing NifU domain protein
cHOG0128 hma RRNAC3083 hypothetical protein
cHOG0128 hwa HQ3465A NifU domain-containing protein
cHOG0128 hla HLAC0148 Hlac_148 nitrogen-fixing NifU domain protein
cHOG0128 hbo HBOR01560 Hbor_01560 thioredoxin-like protein
cHOG0128 hut HUTA0901 Huta_0901 nitrogen-fixing NifU domain protein
cHOG0128 hvo HVO_0070 HVO_0070 NifU-like domain protein
cHOG0128 nph NP0948A NifU domain-containing protein
cHOG0128 hhi 337 HAH_0337 nitrogen-fixing NifU domain-containing protein
MUSCLE (3.6) multiple sequence alignment


2337|chp|nrc1      ----------------MSAESQDGS----DLEERVDNFLRRNFPQIQMHGGTAAVQNINR
901|gene|hut       ----------------MSTESQEGSS---DLEQRVVNFLRRNFPQIQMHGGSAAVQDLDE
13083|hp|hma       MLVQRSKPSRDGIQFTMSTETEDAN----DLRERITNFLRRNFPQIQMHGGSAAIEEIDR
337|gene|hhi       ----------------MSTDTEDAN----DLRERITNFLRRNFPQIQMHGGSAAIEEIDR
3465|gene|hwa      ----------------MSTETADAENETKELKERVTNFLRRNFPQIQMHGGSAAIQHLDP
148|gene|hla       ----------------MSTDTTDADN---DLRERITNFLRRNFPQIQMHGGSAAISHLDR
1560|gene|hbo      ----------------MSTDASNTDD---DLKERVTNFLRRNFPQIQMHGGSAAIQHLDR
948|gene|nph       ----------------MSTETADGDE---ELRERISNFLRRNFPQIQMHGGSAAIQDLDR
                                   **::: : .    :* :*: ***************:**:. :: 

2337|chp|nrc1      EDGVVDLQLGGACSGCGISPMTIQAIKSRMTKEIPEIDVVNAGTGM-------GDSSGM-
901|gene|hut       EAGEVTIMLGGACSGCGISPMTVQAIKSRMTKEIPEINTVHANTGM---EG--GGMGGME
13083|hp|hma       EEGSVTIRLGGACSGCGISPMTIQAIKTRMTKEIPEINEVTARTGMEQQEGMSGGSGGM-
337|gene|hhi       EEGSVTIRLGGACSGCGISPMTIQAIKTRMTKEIPEINEVTARTGMEQQEGMSGGSGGM-
3465|gene|hwa      EAGEVSIQLGGACSGCGISPMTIQAIKSRMVKEISEIETVHADTGM--------DSGGHG
148|gene|hla       ESGEVTVQLGGACSGCGISPMTIQAIKSRMVKEIPEIETVHADTGAG--AGADGDLGGTS
1560|gene|hbo      EEGEVTIMLGGACSGCGISPMTIQAIKSRMVKEIPEIEKVNAETGM-------GGDGGHD
948|gene|nph       ENGEVTIMLGGACSGCGISPMTIQAIKSRMTEEIPEIDTVYADTGS----D--GGSEGMA
                   * * * : **************:****:**.:**.**: * * **         .  *  

2337|chp|nrc1      ----TPSFPGED-GDTEESAEDEGPQAPF
901|gene|hut       ----ESSSPGDSRGGSLDSDDDEGPSAPF
13083|hp|hma       ----SPSFPGESRGGDVGGDDDEGPEAPF
337|gene|hhi       ----SPSFPGESRGGDVGGDEDEGPEAPF
3465|gene|hwa      HGGSSPSFPGET--SDDSGTSDEGPQAPF
148|gene|hla       SGGMSPSFPGET---TDDGGDDEGPQAPF
1560|gene|hbo      S--MSPSFPGES--SSDDSDSDEGPQAPF
948|gene|nph       GGQVSPSFPGET---TSDDDSDEGPDAPF
                        .* **:       . .****.***