HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0127COG0638KOG0863 KOG0173 KOG0175 KOG0176 KOG0177 KOG0178 KOG0179 KOG0180 KOG0182 KOG0183 KOG0185arCOG0097020S proteasome alpha and beta subunitsproteasome.subunit alpha

HOG Organism Gene ID Name Annotation
cHOG0127 nrc1 VNG0880 psmA proteasome.subunit alpha
cHOG0127 hmu HMUK0018 Hmuk_0018 Proteasome endopeptidase complex( EC:3.4.25.1 )
cHOG0127 hma RRNAC0442 psmA3 proteasome subunit alpha
cHOG0127 hma RRNAC1772 psmA1 proteasome subunit alpha
cHOG0127 hwa HQ2661A psmB proteasome beta subunit
cHOG0127 hla HLAC0608 Hlac_608 20S proteasome A and B subunits
cHOG0127 hbo HBOR16660 Hbor_16660 proteasome endopeptidase complex, beta component( EC:3.4.25.1 )
cHOG0127 hut HUTA2664 Huta_2664 Proteasome endopeptidase complex
cHOG0127 hvo HVO_1562 HVO_1562 psmB proteasome subunit beta
cHOG0127 nph NP3472A psmB proteasome beta subunit
cHOG0127 hhi 2300 psmB proteasome subunit beta
cHOG0127 hhi 1190 psmA1 proteasome subunit alpha
MUSCLE (3.6) multiple sequence alignment


880|gene|nrc1       MLLSVPGWYQVVMFNPNNGSEFARNRARLDDTPNPYEPEVGSLPEGDRSQ--AG-SDTVN
608|gene|hla        ------------MRTPT-GDLSDGPAEELGRDQPVFGPEIGEFEHSERRAAQAD-GEGEM
2661|gene|hwa       ------------MRTPMNNDISGRPDSLNGDRSDVFSPELGEFPNADDRA--NDIGDMET
16660|gene|hbo      ------------MRTPTSDDTSGRLDPLNGDHSGVFSPELGEFPNAEQRA--GESTAKET
3472|gene|nph       ------------MRQPDS----SLPRTGQDHTLSPYEPELGEVPSNDLSM--AD-LDNVN
10442|gene|hma      ------------MRDMTPGPDLSGPQAADEFQSDPYAPEVGELP--EQSA--QD-SEKVN
1190|gene|hhi       ---------------MTPGPELSGPQAADEFQSDPYAPEVGELP--EQSA--QD-SEKVN
11772|gene|hma      ------------MHDPEN------------RLTDAYEPEVGNLPN-EDSG--RD-EENVV
2300|gene|hhi       ------------MYDPEN------------RLTDAYEPEVGNLPN-EDGG--RD-EENVV
2664|gene|hut       -----------------MNPDLNM-NPHDSGRTDPYAPELGEIATDE-----GD-GENVT
                                                       : **:*..   :             

880|gene|nrc1       KTGTTIVGLTTQDGVLMASDMRASLGGRVISNKNVQKVEEIQPNAALSISGSVGGAQSFI
608|gene|hla        KTGTTTVGIKTADGVVMATDMRASLGG-MVSSKDVQKVEEVHPRGALTIAGSVSAAQNLI
2661|gene|hwa       KTGTTTVGLKTQDGTVLATDMRASLG-RMVSSKDVQKVEEIHPTGALTIAGSVSAAQSLI
16660|gene|hbo      KTGTTTVGLKTEDGVVLATDMRASLG-HMVSSKNVQKVEEIHPTGALTIAGSVSAAQSLI
3472|gene|nph       KTGTTTIGISTAEGVVIATDMRASLGGRFVSNKNVQKVEQIHPSAALTLVGSVGGAQSFI
10442|gene|hma      KTGTTTIGISTSDGVVIATDMRASLGGRFVSNKNVQKVEEIHPTAALTLVGSVGGAQSFI
1190|gene|hhi       KTGTTTIGISTSEGVVIATDMRASLGGRFVSNKNVQKVEQIHPTAALTLVGSVGGAQSFI
11772|gene|hma      KTGTTTVGLSTEDGVIIATDRRASLGGRFVSNKQVQKVEQIHPTAAMTLVGSVGGAQSFI
2300|gene|hhi       KTGTTTVGISTENGVIIATDRRASLGGRFVSNKQVQKVEQIHPTAAMTLVGSVGGAQSFI
2664|gene|hut       KTGTTTVGLATEEGVVIATDRRASLGGRFVSNKNVVKVEEIHPTAAMTLVGSVGGAQSFI
                    ***** :*: * :*.::*:* *****  .:*.*:* ***:::* .*::: ***..**.:*

880|gene|nrc1       RSLRAEANLYEARRGEYMSIDALSTMASNLLRGGPFFRVVPILGGVDDDGGHVFSLDPAG
608|gene|hla        STLKAETSLYETRRGKDMSMEALSTLTGNLLRSGAFYIVQPILGGVDDEGSHIYSIDALG
2661|gene|hwa       SSIRAEVRLYEARRGEDMSMEALSTLLGNFLRSGGFFIVQPILGGVDDDGPHIYSIDPAG
16660|gene|hbo      RSIRAEVRLYESRRGEDMSMQALSTLLGNFLRSGAFYIVQPILGGFDDEGAHIYSIDPAG
3472|gene|nph       RSLRAEVDLYEARRGEDISINALATLAGNFARGGPFFAINPILGGVDDEGHHVYSIDPAG
10442|gene|hma      RTLRAEVNLYEARRGEDISMKALSTLAGNFARGGPFFAINPILGGVDDDGHHVYSIDPAG
1190|gene|hhi       RTLRAEVNLYEARRGEDISMKALSTLAGNFARGGPFFAINPILGGVDDDGHHVYSIDPAG
11772|gene|hma      RSLRAEADLYEVRRDEPLSIHALATLAGNFARGGPYFAINPIVGGVDEEGSHVYSVDPAG
2300|gene|hhi       RSLRAEADLYEVRRDEPLSIHALATLAGNFARGGPYFAINPIVGGVDEEGSHVYSVDPAG
2664|gene|hut       RTLRSEASLYETRRDEPMSINALATLAGNFARGGPFLAIHPILGGVDDEGSHVYTIDPAG
                     ::.:*. *** **.: :*: **:*: .*: *.* :  : **:**.*::* *::::*. *

880|gene|nrc1       SSMSDTYTAQGSGMPYALGVLEQEYSEDLTMADAEQVAAHAVKSASERDTASGNGIHITK
608|gene|hla        GTTEEEYTVTGSGSQYALGVLEQEYDDDVTVDEAKTMAAKAIQSAVERDLASGNGINVAV
2661|gene|hwa       SIIEEEYTVTGSGSQYALGVLEQQYNEDLSIEEAKTVAARSIESAVERDLASGNGINVCV
16660|gene|hbo      SILEEEYTVTGSGSQYALGVLEQEYSNDLSIEEAKTTAARAIKSAVERDLASGNGINVCV
3472|gene|nph       GVMKDDYTVTGSGLTVAYGTLEREYEDDMTNEEAKRVAASGIKAAVERDTGSGNGVFLAT
10442|gene|hma      GVMKDDYTVTGSGLTVAYGTLEDRYEEDMTNEEAKEVAAASIKAAAERDTGSGNGIYLAD
1190|gene|hhi       GVMKDDYTVTGSGLTVAYGTLEDRYEEDMTNEAAKEVAAASINAAAERDTGSGNGIFLAD
11772|gene|hma      GVLEDDYTVTGSGTMVATGTIEGQYDHGMSLSEARDLAIRAVNAAAERDTGSGNGVVLAE
2300|gene|hhi       GVLEDDYTVTGSGTMVATGTIEGQYDPEMSLSEARNLAIRAVNAAAERDTGSGNGVVLAE
2664|gene|hut       GVMEDDYAVTGSGMQVAYGTIEGEYESDLSTEEAKELATNAVQAASERDTGSGNGLVIAE
                    .  .: *:. ***   * *.:*  *.  ::   *   *  .:::* *** .****: :  

880|gene|nrc1       ITHDGLTTVGHKEFDALL
608|gene|hla        VTDDGVDITRYKDFDDLL
2661|gene|hwa       VTEDGVEITQHEDFEELV
16660|gene|hbo      VTEDGVEITQHKDFEDVL
3472|gene|nph       VTDEDVEIKGHKDFDEVL
10442|gene|hma      VTADGVDINGY-DFDELL
1190|gene|hhi       VTSEGVDINGY-DFDELL
11772|gene|hma      ITDEGVEIDAFDDYESAE
2300|gene|hhi       ITDEGVEIDAFDDYESAE
2664|gene|hut       ITDEGVEIEEFDDLADAL
                    :* :.:    . :