HOG Organism Gene ID Name Annotation
aHOG1265 hhi 2194 asnC4 AsnC family transcriptional regulator
aHOG1265 hhi 4448 HAH_4448 putative AsnC family transcriptional regulator
aHOG1265 hbo HBOR15300 Hbor_15300 transcriptional regulator, AsnC family
aHOG1265 hmu HMUK0745 Hmuk_0745 putative transcriptional regulator, AsnC family
aHOG1265 hut HUTA2728 Huta_2728 putative transcriptional regulator, AsnC family
aHOG1265 hwa HQ3063 lrp transcription regulator
aHOG1265 nrc1 VNG1237 aclR3 transcriptional regulator
aHOG1265 hma Hma_11653 asnC3 Asn family transcriptional regulator
MUSCLE (3.6) multiple sequence alignment


4448|gene|hhi       MLRRNRFFALQILAFPLLSCLYFTLTTLCDCVYARPLVEFTLLEQSFVDEIVVIRIETAV
3063|gene|hwa       ------------------------------------------------------------
2194|gene|hhi       ------------------------------------------------------------
11653|gene|hma      ------------------------------------------------------------
2728|chp|hut        ------------------------------------------------------------
15300|gene|hbo      ------------------------------------------------------------
1237|chp|nrc1       ------------------------------------------------------------
                                                                                

4448|gene|hhi       VALLLVMGPCGLFSRPVQGHRMDDSPLDDVDRSILHQLQLNARQTDT-EIGERVDVTSTT
3063|gene|hwa       ---------------------MKDGELDSVDKQILYHLQRDARGVSSRDIGEELGLSPST
2194|gene|hhi       -------------------MADAEYPIDDLDRNIIYALQQDARHTSASEIAESLDVSART
11653|gene|hma      -------------------MADAEYPIDDLDRNIIYALQQDARHTSASEIAESLDVSART
2728|chp|hut        ---------------------MAVHELDDLDKAILYALQDNARKTSTSTIAERMDVAPST
15300|gene|hbo      ---------------------MSIRDLDSLDRRILYSLQAEARHTSSNDIAASLDVSAST
1237|chp|nrc1       ---------------------MTLDGLDDLDRTILHALQRDARSTSSQDIADEADVSAST
                                              :*.:*. *:: ** :** ..:  *.   .::. *

4448|gene|hhi       VRNRLDKLEGKGVIRGYHPEINYEEAGYPLHVMFVCTVNPNKLDSLADQILDIRGVVTTR
3063|gene|hwa       IRTRLNKLEASGIVRGYYIDIDYDLAGYPLYTKIICTAPVPKRDMLANRARDIHGVTAVR
2194|gene|hhi       VRNRITKLEEAGVIAGYDVDVDYEAAGYQLHTLIVCTAPIHEREEVAQRALDVSGVVAIR
11653|gene|hma      VRNRITKLEDAGVIAGYDVDVDYEAAGYQLHTLIVCTAPIHEREEVAQRALDVSGVVAIR
2728|chp|hut        VRTRIQALEADGILTGYHAEIDYEQTGLQLHTLLVCTAPVPDREELAERAQEVSGVVAVR
15300|gene|hbo      VRNRIQRLESDGIIRGYHADVDYEDAGYQLFTLIVCTAPIPEREELAAAAADVPGVVEVQ
1237|chp|nrc1       VRNRIGRLEERGILTGYHADVDYEQAGYQLYTLIVCTAPVPQREELAAAAVDVPGVVRVE
                    :*.*:  **  *:: **  :::*: :*  *.. ::**.   . : :*    :: **.   

4448|gene|hhi       ELLGGERNVHVEVVAGTVREIEEIRNELADVGMTITSSEIISETQVQSWDHFYPQSGPGA
3063|gene|hwa       EIMTGKRNIYVNAIGQSHDDLNRIAGEIDELGLDIVDEQLIRDEYVCPYHGFLEAEDVES
2194|gene|hhi       EVMTGADNVHVEVVGTDGNDLSRIGRDLNDIGLEVVDEDLIRNEYTRPFHQF--------
11653|gene|hma      EVMTGADNVHVEVVGTDGNDLSRIGRDLNDIGLEVVDEDLIRNEYTRPFHQF--------
2728|chp|hut        EVMTGHENVHIEAIGRDGDDLSRIGRELDEIGLTIEDEDLIRNEYETPFDGF--------
15300|gene|hbo      EVMTGEANVLVRAIGVDGDDLSRIGEELDELGLRVSDEDLIRNTHRRPYSRF--------
1237|chp|nrc1       EVMTGTENIHVFAVGADSDDLSRIGRDLDELGLEVADEDLIRSVHAGPFDGF--------
                    *:: *  *: : .:.    ::. *  :: ::*: : ..::* .    .:  *        

4448|gene|hhi       RQDDGTDDGSVTDQG-
3063|gene|hwa       ADATTDVKSDDASEGR
2194|gene|hhi       ----GHDDTEGESK--
11653|gene|hma      ----GHDDADADTS--
2728|chp|hut        ----SVERA-------
15300|gene|hbo      ------EE--------
1237|chp|nrc1       ----STPSANDTE---