HOG Organism Gene ID Name Annotation
aHOG1260 hhi 160 HAH_0160 hypothetical protein
aHOG1260 hbo HBOR01280 Hbor_01280 hypothetical protein
aHOG1260 hla HLAC0010 Hlac_10 hypothetical protein
aHOG1260 hmu HMUK1070 Hmuk_1070 conserved hypothetical protein
aHOG1260 hut HUTA1016 Huta_1016 conserved hypothetical protein
aHOG1260 nph NP0700 hypothetical protein
aHOG1260 hma Hma_12894 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


700|hp|nph        MSMGAYDEDEHERREKKAATVDAAFDDERTNYEGEIEYEAGDSAEELLDQFKQMQ--
10|hp|hla         MSMGAYDEAEYERREKKNSEVDADFDAERPEYSGSLTYDTGDSTEALLDKFQELQDE
1280|hp|hbo       --MGAYDEDEHERRERKNGSVDATFDDDRTVYHGEVTYDSGDSTEALLDKFREMKDT
1016|chp|hut      MSMGAYDDEEHERRERKNSSVDASFDDDRTDYHGSVDYDSDDSTEELLETFKEIQSD
160|hp|hhi        MSMGAYDDDEHERRERKNSEVDLSEDDDRSTYHGSVDYDGDESTEELLDQFKQINSD
12894|hp|hma      MSMGAYDDDEHERRERKNSEVELSEDDDRSTYHGSVDYDGDESTEELLDQFKQINSD
                    *****: *:****.* . *:   * :*. * *.: *: .:*:* **: *.:::