HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0126COG1005arCOG01546NADH:ubiquinone oxidoreductase subunit 1 (chain H)NADH dehydrogenase/oxidoreductase

HOG Organism Gene ID Name Annotation
cHOG0126 nrc1 VNG0639 ndhG4 NADH dehydrogenase/oxidoreductase
cHOG0126 hmu HMUK1920 Hmuk_1920 NADH dehydrogenase (quinone)( EC:1.6.5.3 )
cHOG0126 hma RRNAC1450 ndhG4 NADH dehydrogenase/oxidoreductase
cHOG0126 hwa HQ1640A nuoH NADH dehydrogenase, subunit H (ubiquinone)
cHOG0126 hla HLAC0707 Hlac_707 respiratory-chain NADH dehydrogenase subunit 1
cHOG0126 hbo HBOR17720 Hbor_17720 NADH dehydrogenase subunit H( EC:1.6.5.3 )
cHOG0126 hbo HBOR21440 Hbor_21440 NADH dehydrogenase subunit H( EC:1.6.5.3 )
cHOG0126 hut HUTA0703 Huta_0703 NADH dehydrogenase (quinone)
cHOG0126 hvo HVO_0981 HVO_0981 ndhG nadh-quinone oxidoreductase chain h
cHOG0126 nph NP2298A nuoH NADH dehydrogenase-like complex, subunit H
cHOG0126 hhi 2031 nuoH NADH dehydrogenase subunit H (ubiquinone)
MUSCLE (3.6) multiple sequence alignment


707|gene|hla        --MGTAPAQLFPEFLVDT-----FGLPGVLGEVVASLIGAALVANIILAFSGIAGPWAKR
17720|gene|hbo      --MHVPLTTLLPETIARVLF---GGAPSLPEQIVSALVAAVIVALVPLNCAAVV-IWAKR
639|gene|nrc1       ----------------------------------------------MLTMTAFAGPWAKR
981|gene|hvo        ----MHLQAVLPDTVSGL-----LGLEGILGDVVGGLVGAFLVANIMLIMTAFAGPWAKR
1640|gene|hwa       MSALLQSKTLLPETIANL-----LGLSGTLGAIIGGLIGAFVIANLLLVQTAVAGPWAKR
21440|gene|hbo      MLPLQSGKVLLPETIANL-----LGLSGTVGQIVGGLIGAFLIANLLLIQTAVAGPWAKR
703|gene|hut        ---MILQATTLTDTIADVLGSLGLDAANPLVVLLAGLLAAALVATIVLLNAALAGPWAKR
2298|gene|nph       ----MLQGAPLPERLAELLG---LGP-GPGSTALAALLGAAIVGTLMMTMTAVAGPWAKR
11450|gene|hma      -----MQSAPLPETLANLLG---LDPNSTAVMILLSLVGAGLIGTLMMTNTALAGPWAKR
2031|gene|hhi       -----MQSAPLPETLANLLD---LDPNSTAVMIVLSLVGAGLIGTLMMTNTALAGPWAKR
                                                                   :  :...  ****

707|gene|hla        KITAAFTDRIAVNRIGPFGLLIIPAAAVQLLAKELIIPEGVDRPTWDIAPILLPASAMLG
17720|gene|hbo      KVTAAFTDRIAPNRTGPFGLLVIVTDVFRLLSKELIVPDGVDRPAYDIGPILVPFSALLG
639|gene|nrc1       KITAAFTDRISVNRVGPWGLGTIVVDSVRLLSKELVIPEGVDRPAYDLAPIVLAGSALFA
981|gene|hvo        KITAAFADRIAVNRIGPFGLLTIVTDAVRLLSKELVVPEGVDRPAWDLAPMVIPFSALLG
1640|gene|hwa       KITAAFTDRIAVNRIGPFGLLVIVADAVRLLSKELVIPEGVDRPAWDLGPLVIPFSALLG
21440|gene|hbo      KITAAFTDRIAVNRVGPFGLLVIVADAVRLLSKELVVPEGVDRPAWDIGPLVIPFSALLG
703|gene|hut        KITAAFTDRISVNRIGPMGIGTIVVDSVRLLSKELIIPEKADRPAYDLAPILLASSALLG
2298|gene|nph       KVTAAFTDRYAVNRLGPFGIIIIVADAVRLLSKELIVPDGVDRPTWDLAPIVLAFSALLG
11450|gene|hma      KITAAFTDRIAVDRIGPYGLFIIVADAVRLLSKELIVPEGVDRPAWDLAPLIIASTALLG
2031|gene|hhi       KITAAFTDRIAVDRIGPYGLFIIVADAVRLLSKELIVPEGVDRPAWDLAPLIIASTALLG
                    *:****:** : :* ** *:  * .  ..**:***::*: .***::*:.*:::. :*::.

707|gene|hla        FSVIPMGQIGPLNIHLADPEVGLALVFAFASIASVSLVMAGYASNNKYSLLGGLRAVAQN
17720|gene|hbo      FAVIPMGSIFGIELQLADPETGLAYAFAVASIATLGLTMCGYASNNKFSLIGGLRAIAAN
639|gene|nrc1       FAVIPMGN----GIQLADPEVGLVFVFAIASIASLGLIMGGYASNNKYSLLGGLRAVAQN
981|gene|hvo        FAVIPMGN----GIQLADPETGLAFAFAAASIASLGIVMTGYASNNKFSLIGALRAVAAN
1640|gene|hwa       FAVIPMGS----GIQLADPETGIVFAFAAGSIASVGLIMMGYSSNNKFSLLGGLRAIASN
21440|gene|hbo      FAVIPMGN----GIHLADPETGLAFAFAASSIASIGLVMMGYGSNNKYSLLGGLRAIAAN
703|gene|hut        FAVIPMGS----GIQVADPEIGLAYVFAVASIASLGLLMAGYASNNKYSFLGGLRAVAQN
2298|gene|nph       FAVIPMGS----GIHLADPEVGLVYVFAIASIASLGLVMAGYASNNKYSLLGGLRAVAQN
11450|gene|hma      FAVIPMGN----GIHLADPEVGLAYVFAVASTTSIGLVMAGYASNNKYSFLGGLRAVAQN
2031|gene|hhi       FAVIPMGN----GIHLADPEVGLAYVFAVASTTSIGLVMAGYASNNKYSFLGGLRAVAQN
                    *:*****.     :::**** *:. .** .* :::.: * **.****:*::*.***:* *

707|gene|hla        LAYEIPLIVTAMSVVVFAGTLQISGVVGAQTE-TLVTIAGFDIPAWFAFVNPFAFVLFLT
17720|gene|hbo      LAYEIPLVVTAASVVLFTGSLQMSEIVATQTN-PLLTVMGVTIPSWYAFVNPFAFVLFLI
639|gene|nrc1       IAYEIPLVLTAASVVLFTGTLQLSEIVAIQQNTTLATIAGVRIPAWFAFVNPFAFVLFVV
981|gene|hvo        IAYEIPLVVTAASVVIFAGSLRMSEIVAVQAE-PLLSVAGVTIPTWFAFVNPFAFALFVI
1640|gene|hwa       IAYEIPLVITGASVILFTGTLQTSAIVAQQSE-PLISIAGVTIPQWFAFVNPFAFVLFVI
21440|gene|hbo      LAYEIPLVITGASVVIFTGSLQMSHIVAEQAN-PLLTVAGVTIPQWFAFVNPFAFVLFVL
703|gene|hut        LAYEIPLVLTGASVVIFAGSLRLSEIVAAQQG-TFLSLGPVAIPNWFAFINPFAFALFML
2298|gene|nph       LAYEIPLVLIAVSVVIFAGSLQMSEIVAAQAE-PLVDLGVATIPQWYAFVNPFAFVLFLI
11450|gene|hma      LAYEIPLILTGASVVIFAGSLQMSEIVAAQQQ-SLIG----PLPSWYAFVNPFAFVLFMI
2031|gene|hhi       LAYEIPLILTGASVVIFAGSLQMSEIVAAQQQ-SLIG----PLPSWYAFVNPFAFVLFMI
                    :******:: . **::*:*:*. * :*. *   .:       :* *:**:*****.**: 

707|gene|hla        ANMAEIGRNPFDIPEAPTEIVGGYQTEYSSAYFVLFYLGEFVHIFLGGAILSVVFLGGAS
17720|gene|hbo      ANLAEVGRNPFDAPEAPTELVAGYQTEYSSVYWVLIYMGEFIHLFLGGAILATVFLGGPA
639|gene|nrc1       ANLAEVGRNPFDTPEAPTEIVAGYQTEYSSAYFVLFYLGEFIHIFLGGAIIATLFLGGPG
981|gene|hvo        ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIAATLFLGGPA
1640|gene|hwa       ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIAATLFLGGPA
21440|gene|hbo      ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIAATLFLGGPA
703|gene|hut        ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLFYLGEFIHIFLGGAIVATLFLGGPA
2298|gene|nph       ANLMEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFLHIFLGGAIIATLFLGGPA
11450|gene|hma      ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIIATIFLGGPA
2031|gene|hhi       ANLAEVGRNPFDIPEAPTEIVAGYQTEYSSVYFVLIYLGEFIHIFLGGAIIATIFLGGPA
                    **: *:****** ******:*.********.*:**:*:***:*:****** :.:****..

707|gene|hla        GPGPESISFIWFVVKVWGFFLFTQWARAAIPRVRIDQLIEIGWKGMLVLSFANLVLTAVI
17720|gene|hbo      --GPVLPGFVWFLVKIWAVFLFTQWARSAVPRLRIDQLIEVGWKGLLVLSFVNLLLTAVI
639|gene|nrc1       --GPFLPGFVWFTIKIWAVYFFTQWCRSAIPRVRIDQLIGIGWKGLLVLSFANLVLTATA
981|gene|hvo        --GPVLPGFVWFTIKIWAFFLFTQWARSAVPRLRVDQFLEIGWKGMLVLSFANLVLTAII
1640|gene|hwa       --GPVLPGFIWFTIKIWLFYFFTQWVRSAIPRLRVDQFLDVGWKGMLVLSFANLALTAII
21440|gene|hbo      --GPFLPGFVWFIIKIWAFYLFTQWMRSAIPRLRVDQFLDVGWKGMLVLSFANLVLTAII
703|gene|hut        --GPLLPGIVWFLIKIWGVFLFTQWARSAVPRVRIDQLIEIGWKVMLVLALINLLLTAII
2298|gene|nph       GPGPEALGIVWFLVKIWAVYLFTQWARSALPRLRIDQLIEVGWKGMLVLAFANLILTAII
11450|gene|hma      --GPVLPGIVWFLIKIWGVFLFTQWARSAVPRVRIDQLIEIGWKGMLVLSLANLLLTAVI
2031|gene|hhi       --GPVLPGIVWFLIKIWGVFLFTQWARSAVPRVRIDQLIEIGWKGMLVLSLANLLLTAVI
                      **   .::** :*:* .::**** *:*:**:*:**:: :*** :***:: ** ***  

707|gene|hla        VGVIA-
17720|gene|hbo      VGMLAT
639|gene|nrc1       LGVTGL
981|gene|hvo        VGVIA-
1640|gene|hwa       VGVIA-
21440|gene|hbo      VGVIA-
703|gene|hut        VGVVA-
2298|gene|nph       VGVLA-
11450|gene|hma      VGVTVQ
2031|gene|hhi       VGVTV-
                    :*: