HOG Organism Gene ID Name Annotation
aHOG1250 hhi 907 HAH_0907 hypothetical protein
aHOG1250 hbo HBOR23480 Hbor_23480 hypothetical protein
aHOG1250 hla HLAC0965 Hlac_965 hypothetical protein
aHOG1250 hmu HMUK3130 Hmuk_3130 conserved hypothetical protein
aHOG1250 hut HUTA2697 Huta_2697 conserved hypothetical protein
aHOG1250 nph NP0208 hypothetical protein
aHOG1250 hma Hma_10157 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


208|hp|nph        -----------MDVTPSSVSAEHERLRENERVP-EHINDVRVRLGDAFGVEVTPVSPAQY
23480|hp|hbo      -----------MELTPDRVVEESQWVRDRSAVVVPLLNETRNQLGELFDTEVGTVTEAEY
965|hp|hla        MANPRPVNGEYMHITSETVRDEHAWVRDREPVVVPTINDTRERLGRIFETDVDPITPEAY
2697|chp|hut      -----------MNVTRDRVESERTWVADRATVVVPLINQLREHLGDAFDTDVEAITDEQY
907|hp|hhi        -----------MRLTPDTVRDEYEWVQDRRSDVVPLVNETRAHLGSQFDVDVEPLTDDAY
10157|hp|hma      -----------MRLTPETVHEEYDWVQERGDDVVPLVNETRAYLGSQFGVDVDTLTDDAY
                             * :* . *  *  .: :.       :*: *  **  * .:* .::   *

208|hp|nph        RREVDAVFADGDRAVNVAALCGLLRSLDCHGDYPGFVVDEFLGRKLAATIAGGEPFALLA
23480|hp|hbo      REEVAAVFADGDVAVNVAGYVALLRELDVRDDYPGFVVDEVLGRELAATIAGGQPLSLLA
965|hp|hla        RREVDAVFADGEVAVNVAGCVALLRDLDVAGDYPGFVVDEVLGRELAATIAGGRPLSLLA
2697|chp|hut      REAVTAVFADGDLAVNVTALVGLLRELDVTDDYPGFVVDEFLGRELAATIAGGQPRGTLA
907|hp|hhi        TAAIDEVFADGDRAVNVAALVHLLRELDVTGDYPGFVVDELLGRELAAMIAGEQPLRLLA
10157|hp|hma      TAAIDEVFADGDRAVNVAALVRLLRGLDVTDDYPGFVVDELLGRELAAMIAGEQPLRLLA
                     :  *****: ****:.   *** **  .*********.***:*** ***  *   **

208|hp|nph        EATFHVADIHTHGGAD----EAAGADDLEAALAAGFQTRLPGWEWTEGESPFGVTGNG--
23480|hp|hbo      QATFHFADTMTHTD------GTAGADDLDAALAAGFQTRLPGWEWRERPNPFAVARNQ--
965|hp|hla        QATFHFVDVHVSEDATADGAGAAGADDLDAALAAGFQTRLPGWDWREGESPFAVASPTDE
2697|chp|hut      EATYHYADVHTHGSDD----DVAGLDDLDAALAAGFQTRLPGWKWTATASPFSVDPE---
907|hp|hhi        EATFHVADVRTHGDDT----AAAGADDLDAALAAGVQTRVPGWPWQQTESPFAVE-----
10157|hp|hma      EATFHLADVRTHGDDT----ATAGADDLDAALAAGVQTRVPGWPWQQTENPFAVE-----
                  :**:* .*  .  .       .** ***:******.***:*** *    .**.*