HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0125COG0633KOG3309arCOG02844Ferredoxinferredoxin

HOG Organism Gene ID Name Annotation
cHOG0125 nrc1 VNG2293 ferA2 ferredoxin
cHOG0125 hmu HMUK0856 Hmuk_0856 ferredoxin
cHOG0125 hma RRNAC2526 fer1 ferredoxin
cHOG0125 hwa HQ2001A fdx ferredoxin (2Fe-2S)
cHOG0125 hwa HQ3457A fdx ferredoxin (2Fe-2S)
cHOG0125 hla HLAC2176 Hlac_2176 ferredoxin
cHOG0125 hbo HBOR02500 Hbor_02500 ferredoxin
cHOG0125 hut HUTA1779 Huta_1779 ferredoxin
cHOG0125 hvo HVO_2995 HVO_2995 2Fe2S ferredoxin.
cHOG0125 nph NP1272A ferA_1 ferredoxin I 1
cHOG0125 hhi 2956 fdx5 ferredoxin
MUSCLE (3.6) multiple sequence alignment


1779|gene|hut       -----------------------------MPTVEYLNYEALDDHGWDMDDDDLFEKAESS
12526|gene|hma      MNPRAVPHYFARPKTEGQSLTGRGSNNQVMPTVEYLNYEVVDDNGWDMYDDDVFGEASDM
2956|gene|hhi       ----------------------------------------MDDNGWDMYDDDVFAEASDM
2001|gene|hwa       -----------------------------MATVEYLNYETLDDKGWEMDDNDLFEKAADS
3457|gene|hwa       --------------------MPWRTCAILMATVEYLNYESLNDKGWEMDDEDLFEKAADS
2176|gene|hla       ----------------------------MMPTVEYLNYEVLDDHGWSMDDDDLFEEAADA
2995|gene|hvo       -----------------------------MPTVTYLNYEVLDDNGWDLDDDGLFEQAADA
2500|gene|hbo       -----------------------------MPTVEYLNYEVLDDNGWDLDDDDLFENAADA
2293|gene|nrc1      -----------------------------MPTVEYLNYETLDDQGWDMDDDDLFEKAADA
1272|gene|nph       -----------------------------MPTVEYLNYEVLDDHGWEMDDDDLFENAADA
                                                            ::*:**.: *:.:* :* . 

1779|gene|hut       DLGENDYGAIDVAEGEYILEAAEAQGYDWPFSCRAGACANCAAIVKEGDIDMDMQQILSD
12526|gene|hma      DLDDEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVLEGDIDMDMQQILSD
2956|gene|hhi       DLDGEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVLEGDIDMDMQQILSD
2001|gene|hwa       DLDNEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVTEGEIDMDMQQILSD
3457|gene|hwa       DLGDEDYGSLEVNEGEYILEAAEAQGYDWPFSCRAGACANCAAIVTEGEIDMDMQQILSD
2176|gene|hla       DLDAEDYGSLDVNQGEYILESAEAQGYDWPFSCRAGACANCASIVMEGDIEMDMQQILSD
2995|gene|hvo       GLDAEDYGEMEVNQGEYILEAAEAQGYDWPFSCRAGACANCAAIVKEGEIDMDMQQILSD
2500|gene|hbo       GLDGEDYGTLEVNQGEYILEAAEAQGYDWPFSCRAGACANCAAIVKEGEIQMDMQQILSD
2293|gene|nrc1      GLDGEDYGTMEVAEGEYILEAAEAQGYDWPFSCRAGACANCASIVKEGEIDMDMQQILSD
1272|gene|nph       DLDEEDYGSLDVAEGEYILEAAEAQGYDWPFSCRAGACANCAAIVKEGEIDMDMQQILSD
                    .*. :*** ::* :******:*********************:** **:*:*********

1779|gene|hut       EEVEDKGVRLTCVGTPTEDDVKIVYNAKHLDYLQNRVI-
12526|gene|hma      EEVEDKNVRLTCIGSPDADEVKIVYNAKHLDYLQNRVI-
2956|gene|hhi       EEVEDKNVRLTCIGSPDADEVKIVYNAKHLDYLQNRVI-
2001|gene|hwa       EEVSERNVRLTCIGSPAADNIKIVYNAKHLDYLQNRVIG
3457|gene|hwa       EEVSDKNVRLTCIGSPAADSVQIVYNAKHLDYLQNRVI-
2176|gene|hla       EEVEEKNVRLTCIGSPATDEVKIVYNAKHLDYLQNRVI-
2995|gene|hvo       EEVNEKNVRLTCIGSPVEDEVKIVYNAKHLDYLQNRVI-
2500|gene|hbo       EEVSEKNVRLTCIGSPETDEVKIVYNAKHLDYLQNRVI-
2293|gene|nrc1      EEVEEKDVRLTCIGSPAADEVKIVYNAKHLDYLQNRVI-
1272|gene|nph       EEVEEKMVRLTCIGSPAADEVKIVFNAKHLDYLQNRVI-
                    ***.:. *****:*:*  *.::**:*************