HOG Organism Gene ID Name Annotation
aHOG1249 hhi 1280 HAH_1280 hypothetical protein
aHOG1249 hbo HBOR16190 Hbor_16190 uncharacterized conserved protein
aHOG1249 hla HLAC1481 Hlac_1481 protein of unknown function DUF790
aHOG1249 hmu HMUK2842 Hmuk_2842 protein of unknown function DUF790
aHOG1249 hut HUTA0339 Huta_0339 protein of unknown function DUF790
aHOG1249 nph NP4066 hypothetical protein
aHOG1249 hma Hma_10620 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4066|hp|nph        MLTKELLRVSRAGGGYHPQFTTAADEDVAARVLGVYQGHVGEPRAQLESALTDLERET--
1280|hp|hhi        MLTKDLLRVSRAGGGYHLQFADADAERLAARVLGIYQGHVGESRGTLVAALTDVEREA--
10620|hp|hma       ---------------------------------------------MLETALADVEQEA--
339|hp|hut         MLTKDLLAVSRAGGGYHPEFVDEGHRDLAARVIGVFQGHVGERRETLTDALTEVERES--
1481|gene|hla      MLRKDLLRVSRAGGGYRPRFATREHRPLAARVLGTFESHVGERRGDLDDALAALEADAAE
16190|hp|hbo       MLTKDLRRVSRAGGGYHPQFVGRESRPLAARVIGVFQGHVGEPRHRLDDALSSLEDEA--
                                                                 *  **: :* ::  

4066|hp|nph        --GQFKLVRGFAKLLEREAAFETRSPVSPRRARTAAFVAAESVGVVTEAD-RDAALVAAA
1280|hp|hhi        --DDFKLVRGLAKLVEREATFGTQALVDPVRARRRVFEAAADVGVVTEAE-RQQALSEAA
10620|hp|hma       --DDFKLVRGLAKLVEREATFETQAPIDPVRARRRVFEAASDVGVVTEAE-REQALAEAA
339|hp|hut         --DDFKLVRGFAKLLERDATFETRAPLPPERARRAAFEAAESIGVVTEGE-RARALQQAA
1481|gene|hla      SGGDFKLVRGLAALIERECVFETRAPVPPQRVRRAAFEAAEAVGVASETE-RETAIDRAA
16190|hp|hbo       --DDFKLVRGLAALLDREATFEVVAPLPPTRVRRATFEEAETAGVPTTTEARTAVLKRVA
                     .:******:* *::*:..* . : : * *.*  .*  *   ** :  : *  .:  .*

4066|hp|nph        DDLDTSADALAASLFADRDCEQRLTAFDVDYDPESLCTQYDLSLAQTALFDATSVRVRTD
1280|hp|hhi        DHFGTDAETLADTLYADRDSRQILTDVDSRWGPAELRTQYDLSLAQTALFDATEVRVRSS
10620|hp|hma       DHFGTDAASLADTLYADRDSRQVLTAVDSRWGPAELRTQYNLSLAQTALFDATEVRVRSS
339|hp|hut         DRLGSDRAAIESSLYADLDARQILTEFDRQWTPAALLEQYNLSLAQTALFDATAIRISSA
1481|gene|hla      DALGIEPGDVEASLYADRDVNEILVDADVRWDPDSLLEQYDLSLAQTALFDATEVRIRSN
16190|hp|hbo       DRLGTDTEAIEESLYADRAVNEVLTEFDARWSPDSLLEQYNLSLAQTALFDATEVRVRSS
                   * :. .   :  :*:**    : *.  *  : *  *  **:************ :*: : 

4066|hp|nph        DPKRLVSAVKRLRLLYEIRRADAG-RDVVVTGPDALFKRSRRYGTRFARLLRTVAATADW
1280|hp|hhi        DPKALVSAVKRLRLMYEIRQTANG-REVIVTGPDALFSNTRRYGTRFARLLRTVAAASEW
10620|hp|hma       DPKALVSAVKRCRLMYEIRRTGNG-REVVVTGPDALFSNTRRYGTRFARLLRTVATANEW
339|hp|hut         DPKALVRAVKRLGLLYEVRKTDDGARELHVTGPDALFKSTRRYGTQFARLLRSVAKTDDW
1481|gene|hla      DPKRLVSAVKRLRLMYEVETTPEG-RELVVTGPDALFSRTRRYGTAFARLLRTVAKSAEW
16190|hp|hbo       DPKRLVSAVKRLGLMYEIRRDGET-RELVVTGPDALFRRTRRYGTAFARLLRTVAGTAEW
                   *** ** ****  *:**:       *:: ********  :***** ******:** : :*

4066|hp|nph        QLEATIDDRGTERRLRLEAGDIEVPDTDPVAEPTFDSAVEADFYSRFSSLDLDWRLLREP
1280|hp|hhi        ELTATIDDRGTERELTLSDADVSVPGVEPVTEVSYDSGVEADFAGRFAALDLDWDLIREP
10620|hp|hma       ELTATVDDRGTERKLTLSDGDVSVPGVEPVTEVSYDSGVEADFAGRFAALDLDWDLIREP
339|hp|hut         RLEATIDDDGRERTMTLTDADVSVPDVDPIVEPTYDSDVEADFATRFASLDLPWDLRREP
1481|gene|hla      ELSATIDDRGRERTMRLSDGDVTVPGVEPVAEPDFDSGVEADFAGRFRGLDLDWTLVREP
16190|hp|hbo       TMTATIDDRGTEREMTLSDADLSVPNVEPVTEPTYDSGVEADFAARFEGLDLDWELVREP
                    : **:** * ** : *  .*: **..:*:.*  :** *****  ** .*** * * ***

4066|hp|nph        EPLAAGEHVVIPDFAFEWK----------------------HGDFRVFFEIMGFWTPEYV
1280|hp|hhi        EPLAAGEHVIIPDFAFEWRPGADTGVRDTGRSGGGSDGAASDAPFRIFFEIMGFWTPEYV
10620|hp|hma       EPLAAGEHVVIPDFAFEWRPGADTGVQDTGR-GESTDRTDGDTPFRIFFEIMGFWTPEYV
339|hp|hut         EPLEAGASVAIPDFAFEYR----------------------HGDFRVFFEIMGFWTPAYV
1481|gene|hla      ETLETGNRVMIPDFAFDYD----------------------HADFRLFFEVMGFWTPEYV
16190|hp|hbo       EPLAAGARAMIPDFAFVYRPGGDAAGENSGD----------DPEFRVFFEVMGFWTPEYV
                   *.* :*  . ****** :                          **:***:****** **

4066|hp|nph        EKKLSRFSDL-EDVAFLVAYDESLGVGEDIEATGQRAFPYTKTVRLKDVRDALRPYEETL
1280|hp|hhi        EKKLTRLDAL-EDVEMLVAVDESLGVGDEIEATETRAIPYAGTVSVKDVRDALRPYEERL
10620|hp|hma       KKKLTRLDAL-EDVEMLVAVDESLGVGEEIEATDNRAIPYSGTVRVKDVRDALRPYEERL
339|hp|hut         EKKLAQFDTI-DDVELLVAYDESLGVGEAIEARDHRAIPYTGSVRVKDVRDALRRYETDL
1481|gene|hla      AKKLGQLADV-EDVDLLVAVDESLGVGEEIAARDHRVVSYSGTVRVKAIVDVLREYEAEF
16190|hp|hbo       EKKLDQFATVSDDVELVVAADESLAVAEDVAELDHRVVTYSGSVHVKDVVDLLRIYEDEL
                    *** .:  : :** ::** ****.*.: :     *...*: :* :* : * ** **  :

4066|hp|nph        REASAASLPDRLVPDADVTTLAAVADDHGVSEAVVESATFPEHDRVGRTLVRPAVCDAVD
1280|hp|hhi        VRESAAEIPDELRPDADVTSLADLAAEYGVSEDALEDVAYPDHERVGRTLVSPAVLDDLA
10620|hp|hma       VRESVAEIPDELRPDADVISLTDLAAEHGVSEDALEDVAFPAHERVGRTLIDPVVLDELA
339|hp|hut         VAANVAELPAELEPEADVITLAELAETHGVSEDAVETTSFPEHELVGRTLVRPSILADLA
1481|gene|hla      VADAAADLPESLSPDADAIGLDELADEHGVSVEAIEDKSFPDHELVGRTLVRPAVLEAAG
16190|hp|hbo       IAEAADDLPDELSPDADVASLAELADSYAVAEDALESVSFPDHEQVGRALVRPAVVDALG
                       . .:*  * *:**.  *  :*  :.*:  .:*  ::* *: ***:*: * :     

4066|hp|nph        EELTAGMSLAEAETVLSGHGIDETSAMLSALGYRVEWEGLGGGTVTEA---
1280|hp|hhi        EEIEPGMAYEAASNRLADYGIEDDSAALARLGYRVAWEGLGEGTIRPRE--
10620|hp|hma       EEIEPEMAYQAAIGRLSAHGIEDDSAALAHLGYRVAWEGLGKGTIQPRE--
339|hp|hut         QRIEPEMTLSEAEAVLDEYGIDDASAVLSRLGYRVEWEGLGGGVIRSQKSA
1481|gene|hla      EKLEAGMAFSEVESILDDYAIDDASAALSRLGFRVEWEGLGGGTVREKGE-
16190|hp|hbo       DELEAGMSLSDAEAILEEYGLSDASAVLSRLGYRVEWEGLTGGTLREKQ--
                   : : . *:   .   *  :.:.: ** *: **:** ****  *.: