HOG Organism Gene ID Name Annotation
aHOG1241 hhi 2124 HAH_2124 putative glycosyltransferase
aHOG1241 hhi 1844 gspE2 type II secretion system protein E
aHOG1241 hbo HBOR20810 Hbor_20810 ATPase, type IV secretory pathway VirB11 component like protein
aHOG1241 hla HLAC0978 Hlac_978 type II secretion system protein E
aHOG1241 hmu HMUK2148 Hmuk_2148 type II secretion system protein E
aHOG1241 hut HUTA2859 Huta_2859 type II secretion system protein E
aHOG1241 nph NP4022 ATPase
aHOG1241 hma Hma_11250 gspE2 type II secretion system protein
MUSCLE (3.6) multiple sequence alignment


2124|gene|hhi       ---------------------------------------MNSLESEVLSL----VSEN--
978|gene|hla        MTTEDAERSPVSSDETAGS-------------------PASDHRASGPPPSDPSVSDR--
20810|gene|hbo      MATDDGASSPVRQDSDGDDEGALEGEVDGDRVALEGNVAPGGATAEGGDADTPNGDASGG
4022|gene|nph       MAVDEG---------EGDD---------------------GGAASDAGPA-APEADDNGT
2859|gene|hut       MAIDDK---------DGGD---------------------GSLRSRATSL-FGDSDDE--
1844|gene|hhi       MAIDD----------------------------------TGGGESDQVNG-GGNLTDE--
11250|gene|hma      MAIDD----------------------------------TGGGESEQVNS-GGNLTDE--
                                                            ..  :               

2124|gene|hhi       ----------VEWLAEYQIETG--------------------------------------
978|gene|hla        -PVSVGR---YSW-RSFLRDRGRDDAATELYADISEEPVVPATAVDAHFEDSVDRVIRAA
20810|gene|hbo      PTVAVGA---YTW-AHFLDEFG--------------------------------------
4022|gene|nph       QSATVGT---YDW-DDFRREFH--------------------------------------
2859|gene|hut       QPAEAEEEDAYNW-VDFRREFH--------------------------------------
1844|gene|hhi       -PVRVGE---YTW-DDLRREVH--------------------------------------
11250|gene|hma      -PVRVGE---YTW-DDLRREVH--------------------------------------
                                *      :                                        

2124|gene|hhi       ------------------------------------------------------------
978|gene|hla        GVDETYTADGDTAVSGHGTPEAGTVVIGTDHVVLSGAAVVPAGTSTAAVAPDPVESVDET
20810|gene|hbo      ------------------------------------------------------------
4022|gene|nph       ------------------------------------------------------------
2859|gene|hut       ------------------------------------------------------------
1844|gene|hhi       ------------------------------------------------------------
11250|gene|hma      ------------------------------------------------------------
                                                                                

2124|gene|hhi       ------------------------------------------------------------
978|gene|hla        VEGDEDDVETDRGEEDGEADDGEGDDEDGSDEDGSDETAEAADESAESDRADSDDPDARP
20810|gene|hbo      ----------------------------------------------EDGDVTSLYRGHDP
4022|gene|nph       ----------------------------------------------D-------------
2859|gene|hut       ----------------------------------------------DGGAFDR-------
1844|gene|hhi       ----------------------------------------------DGGRFDR-------
11250|gene|hma      ----------------------------------------------DGGRFDR-------
                                                                                

2124|gene|hhi       ----------------------------------------PDSGGIEDHILGRVVGDNYA
978|gene|hla        GISIDGAGVSGVVVVPAEDVEPVPRRTPTDEEWSRVDIDPSEFLGFDPSETGYRVGAAAA
20810|gene|hbo      RETRERPGSSRWDDADEDEPTTPTRPTRDDWQNVSLDPTDEQYLGHHPVETEDEIETAAS
4022|gene|nph       -----------------------------------------------------------S
2859|gene|hut       ----------------------------------------SEYLGFDPHRTAAVLRERAS
1844|gene|hhi       ----------------------------------------SVYLGFEPRELSQRLEDAAS
11250|gene|hma      ----------------------------------------SVYLGFEPRELSQRLEDAAS
                                                                               :

2124|gene|hhi       TEEF----------ALALAVLRSRGLLPDYDEHF--------------------------
978|gene|hla        VGDVLWDLCSARYNLYEVPVLKGYYTWDDYRDEYFLDEEGNPPTEENEEGEEEPLEFTHD
20810|gene|hbo      EAKRIQSAFEEFCDPETTPVVKDVWMWEHYKREDYYEDDGSRPRD--EDGEIDRF-----
4022|gene|nph       DADA-------------------------------------------------PF-----
2859|gene|hut       DAETLNTHWQAFADPETTPVRKGEYYWEHFKREYYYESDGSVPHD--DAGEKIPF-----
1844|gene|hhi       AGKTLQAPFEEYLDPTTTPVAKDIYTWEHFKQEYYYE-DGSLPRD--SDGEVIPF-----
11250|gene|hma      AGKTLQAPFEEYLDPTTTPVAKDIYTWEHFKQEYYYE-DGSLPRD--SDGEVIPF-----
                      .                                                         

2124|gene|hhi       --ERAMNFHA-----RTSAGYPRGTHAEHYQHRRLGFIEALLKAKQF-----GSRTQLSK
978|gene|hla        DKVEALGFDPDRTEELLGAGGGAAADLAELVDERTVDVNPEIDEDAFFSTEEGHTTLANR
20810|gene|hbo      DAEAALGFDPSVIENALARGSHRADELDDVIEERTVNVNEELDEDAFFSDSHGATTAANR
4022|gene|nph       SPESYLGFDPRDADGRLGVAHIAAETVAEAANRRTVRVDPDVDEAEFFTTDGGAATVTTR
2859|gene|hut       EESDHLGFEPDELAGRMSHGQNLAEELVDLVDERTVDVNEELDEDAFFSTVEGNTTVVNR
1844|gene|hhi       DESEYLNFDPEHTENKLSAAEDIASELHEYVDENTVDVNPELDEDEFFSTRDGHTTVVNR
11250|gene|hma      DASEYLHFDSEHTENKLSAAEDIASELHEYVDENTVDVNPELDEDEFFSTRDGHTTVVNR
                         : * .       . .   .         .   ::  :.   *     *  *  ..

2124|gene|hhi       W--------------RDVVHRWDTR----------DNPSNCNWHAMNVLLDRLVYNVTG-
978|gene|hla        YDLEKAVPMPKKTHFREIERYWVNKPYAFVIVFRSTKENEVKYYAIQPHRTEIETDLVEF
20810|gene|hbo      YDLEKAVPMEKKTHFREVERYWVNKPHSFVVIFHSDKENEKKYYVVEPYQNRIERDLAEF
4022|gene|nph       YDLEKAVPDEKKQHFREVDRYWVNEPYAFVIIFHSEKENEKKYYLVEPHLSPIEDDLREF
2859|gene|hut       YDLERAVPMEKKRHFEEVERYWVNKPYACVVLFHSKKENERKYYVIEPALNDIERELKGF
1844|gene|hhi       YDLEKAVPQSKKSHFNELERYWVNKPYACVIIFHSRKENEKKYYVIEPYLTDIEIDLREF
11250|gene|hma      YDLEKAVPQSKKSHFNELERYWVNKPYACVIIFHSRKENEKKYYVIEPYLTDIEIDLREF
                    :               :: . * .            : .: ::: ::     :  ::   

2124|gene|hhi       -SGRFR--------------------RHAFREFIQMLGYWQF-----------DGLFTDS
978|gene|hla        LTGKLRTSIKYA-DESIAGGDEEFREGVIVDETLTLLDRYDLYERTDDDRGVVDDLVDDL
20810|gene|hbo      LTGKLRTAIKYN-DESTIGTGDGTRRRVIEQQSLELLERYDLYDPGPDGYSDALSLAPDP
4022|gene|nph       LAGKLKTAIKYSSDETVVHGGEDVRASVIESETHALLDRYDLYADGARPDENGDGLVATL
2859|gene|hut       LGNKLKTAIKYAEEGVGVEDGEADRAAVIEREAQDLLKRYDIY-EDAIESGAGTGSTDWL
1844|gene|hhi       LSGKLKTAIKYSEDDVIVQGTDADRAQVIQREAEQLLSRYDLY-NGTVSSSGEESVLGQV
11250|gene|hma      LSGKLKTAIKYSEDDVIVQGTDADRAQVIQREAEQLLSRYDLY-DGSVSSRGEESVLGQV
                      ..:.                         :   :*  :::            .     

2124|gene|hhi       FDAY--------------------------------------------DFEHVD------
978|gene|hla        VDRF----------------------------GFDLTEGIAGRISESLGYEPPTE-----
20810|gene|hbo      TEPT--EEPEPGAVAGLFTRLGLGGEDAATDGGKASRDGSLGTFARRLGLSEESFGGRLG
4022|gene|nph       SSLVDTDDGEAGLFDGLDIRAQFGFGDADDEDASDRGEAN--------GGDNASPD----
2859|gene|hut       KELV--------------------------------------------GMDTETDA----
1844|gene|hhi       KELF--------------------------------------------GLDEETQ-----
11250|gene|hma      KELF--------------------------------------------GLDEETQ-----
                     .                                              . .         

2124|gene|hhi       ---------------------PPYVPLAYHMYTAALLHRYYYYTDNSLVRRIFLRSVRVL
978|gene|hla        ------PESESAPAKILARPEPAVLAEDSETLSKHQVEKLLY-----FLKRDFIGYERID
20810|gene|hbo      SLFADPPRDDPGLDGIAARPEPAVLADDDATLTEYQVEKLLY-----VLRRDFIGYERID
4022|gene|nph       ---TDDAERGSSLRAVSARPEPAVVEEDAETLTSHQIEKLLY-----MLKRDFIGYERID
2859|gene|hut       ---IEPAEESSALAGIAARPEPAIIEEDPDTLTEYQVEKLLY-----LLKRDYIGYGKID
1844|gene|hhi       ------SETTGQLSGISTRPEPAILEDDDPKLNEYQVEKLLY-----MLKRDFVGYARID
11250|gene|hma      ------SETTGQLSGISTRPEPAILEDDEPKLNEYQVEKLLY-----MLKRDFVGYARID
                                         *. :       .   : .  *     .:.* ::   .: 

2124|gene|hhi       LPYLPKNGHPTYRGRSAGHIFTYGVSFYVLLAAAIETE---DTSYLTVARPIIEQIT---
978|gene|hla        PIKYDINVEDISCDGYNSPVFVYHSDYEQIITNVYHGTDELDDFVVKLAQRSGKGISKRR
20810|gene|hbo      GIKHDINVEDISCDGYNSPVFVYHSDYEQIISNVVHAETELDDFVVKLAQRSGKGISKRR
4022|gene|nph       GIKHDINVEDISCDGYNSPVFVYHSDYEQVITNVYHGEDELDEFVVKLAQRSGKGISKRS
2859|gene|hut       PIKHDINVEDVSCDGYNSRVFVYHTDYEQIISNVEHGESDLDDFVVKLAQRSGKGISKRQ
1844|gene|hhi       GVKHDINVEDISCDGYNSRVFVYHTDYEQIISNVEHGEGELDDFVVKLAQRSGKGISKRQ
11250|gene|hma      GVKHDINVEDISCDGYNSRVFVYHTDYEQIISNVEHGKGELDDFVVKLAQRSGKGISKRQ
                          *      .   . :*.*  .:  ::: .       *   :.:*.   : *:   

2124|gene|hhi       ---DFQRPDG-RLPVVANRKAYDERIECQAQYAY-----------HSVYNAHCSAWLARS
978|gene|hla        PQVDATLPDGSRAQLTLGREVSDHGTNYTIRQFNEIPFTPIDLINWKTFSLDEMAFLWLS
20810|gene|hbo      PQVDATLPDGSRAQLTLGREVSDHGTNYTIRQFKDVPFTPIDLVNWNTFSLEEMAFLWLC
4022|gene|nph       PQVDATLPDGSRSQLTLGREVSDHGTNYTIRQFKDVPFTPIDLINWNTFSLDEMAFLWLC
2859|gene|hut       PQVDATLPDGSRAQLTLGREVSDHGTNYTIRQFKDVPFTPVDLINWNTFSLDEMAFLWLA
1844|gene|hhi       PQVDATLPDGSRAQLTLGREVSDHGTNYTIRQFKDVPFTPIDLINWNTFSLDEMAFLWLC
11250|gene|hma      PQVDATLPDGSRAQLTLGREVSDHGTNYTIRQFKDVPFTPIDLINWNTFSLDEMAFLWLC
                       *   *** *  :. .*:. *   :   .              ...:.    *:*  .

2124|gene|hhi       LSLLKSTDW---TAKGESKQARA---FFRERGGLFSVDQERYSAV-------------VS
978|gene|hla        IENHKSLIFAGGTASGKTTSLNAVSLFIPSNAKIVSIEDTREVELPQRNWIASVTRPSFS
20810|gene|hbo      IENHKSLIFAGGTASGKTTSLNAVSLFIPSNSKIVSIEDTREVELPQRNWIASVTRPSFS
4022|gene|nph       IENNKSLVFAGGTASGKTTSLNAVSLFIPSKAKIVSIEDTREVELPQRNWIASVTRPSFS
2859|gene|hut       IENNKSMIFAGGTASGKTTSLNAISLFIPSNAKIVSIEDTREVELPQRNWVASVTRPSFG
1844|gene|hhi       IENNKSLIFAGGTASGKTTSLNAVSLFIPSNSKIVSIEDTREVELPQRNWVASVTRPSFG
11250|gene|hma      IENNKSLIFAGGTASGKTTSLNAVSLFIPSNSKIVSIEDTREVELPQRNWVASVTRPSFG
                    :.  **  :   **.*::.. .*   *: ... :.*::: *   :             ..

2124|gene|hhi       NGRGGNYDA--ALSLAMLD-----VSGELCSLPPGPSGSIESSGHVLWIHQNDTRLWDSV
978|gene|hla        DDDKGDIDEFDLLEAALRQRPDYIVMGEIRGEEGRTAFQVMSTGHTTYTTFHADTVGEVL
20810|gene|hbo      DDDKGDVDEFDLLEAALRQRPDYIVMGEIRGEEGRTLFQVMSTGHTTYTTFHADSVGEVL
4022|gene|nph       DGDKGDVDEFDLLEAALRQRPDYIVMGEIRGEEGRTLFQVMSTGHTTLTTFHADSVGEVI
2859|gene|hut       EDQTGDIDEFDLLEAALRQRPDYIVMGEVRGEEGRDLFQVMSTGHTGYSTFHADTVGEVI
1844|gene|hhi       EDDKGDVDEFDLLEAALRQRPDYIVMGEIRGEEGRTLFQVMSTGHTTYTTFHADSVGEVI
11250|gene|hma      EDDKGDVDEFDLLEAALRQRPDYIVMGEIRGEEGRTLFQVMSTGHTTYTTFHADSVGEVI
                    :.  *: *    *. *: :     * **: .       .: *:**.     :   : : :

2124|gene|hhi       R--TTGTID------------------QYSGNRLVGSKQISTRAGNFD------------
978|gene|hla        KRFTTEPINVSKTMFTALDLVSVQTSTRVQGKKVRRNKSL-TEINHYDAENDEINVQDVF
20810|gene|hbo      KRFTTDPINVSKTMFTALDLVSIQTSTRVQGNKVRRNKSL-TEINHYDPENDEINVQDIY
4022|gene|nph       KRFTTDPINVSKTMFTALDLVSIQTQTRVGGNKVRRNKSL-TEINHYDPENDEINVRDVY
2859|gene|hut       KRFTTDPINVSKTLFTALDLVSIQTQTRVQGRKVRRNKTL-TEINEYSPENDEINVRDVY
1844|gene|hhi       KRFTTEPINVSKTLFTALDLVSIQTQTRVDGNKVRRNKSL-TEINEYSAENDEINVRDVY
11250|gene|hma      KRFTTEPINVSKTLFTALDLVSIQTQTRVDGNKVRRNKSL-TEINEYSAENDEINVRDVY
                    .  ** .*:                  .  *..:  .* : *  . :.            

2124|gene|hhi       -WN---------------RRFTFD--CTEITLHDEV-------------AASTAETEDIT
978|gene|hla        QWQAETDEFLQMGDSNTLEDIMFDRGWSRKTLDEELRKRRVVLAYLIDRGLNSYAQVAAT
20810|gene|hbo      QWQAETDEFLQMGSSNTLEEIRFDRGWTEDRLQHELFVRQVVLAYLIDRGLNTYTQVAAT
4022|gene|nph       QWQAETDQFLEMGTSNTLEQIRFDRGWTQQRLDSELRKRKVALAYLIHEGLNTYTQVAAT
2859|gene|hut       QWQAESDEFLQMGSSSTLEEIKFDRGWDQDTLDEELFMRKVVLAYLIEQGLNTYTEVAAT
1844|gene|hhi       EWRAETDEYIQMGNSNTLEEIKFDRGWTQDKLDEELFKRKVVLAYLIEKGLNTYTQVAAT
11250|gene|hma      EWRAETDEYIQMGNSNTLEEIKFDRGWTQEKLDEELFKRKVVLAYLIEKGLNTYTQVAAT
                     *.                 : **       *  *:             . .:      *

2124|gene|hhi       VQMTYSLPETC--------------SICSVEGVSLSTER------------------VDT
978|gene|hla        FQAFINDPETVLALMANEELERSLEDLREMESVLINVDRDKEEMVPRPDPDEAGREEVER
20810|gene|hbo      LQAFINDSDTILTLMAEDDLERSLEDLREMESVHINVDPEKEDMVPRPDPPEDVLKLCRD
4022|gene|nph       LQAFVNDPDTIISLIASGDLERSLEDLREMESVQIDIDPEKEAMVPRPDPGEALREETAA
2859|gene|hut       LQAFINDPKTIMTLIANDQLDHSLEDLREMESVQITVDPAKEEMVPRPDPPDELLSEATD
1844|gene|hhi       IQAFINDPDTILTLIANDQLELSLEDLREMESVKIDIDPEKEEMVPRPDAPPEMVEETKQ
11250|gene|hma      IQAFINDPDTILTLIANDQLELSLEDLREMESVKIDIDPEKEEMVPRPDAPPEMVEETKQ
                    .*   . ..*               .: .:*.* :  :                      

2124|gene|hhi       VLGSG-----TTYR------VESTL----------------------------------G
978|gene|hla        ILAEA-EDLFAEYRGRMPDSVADAL--LDVAPARNVEAQPVADREALAQAADEAAALDGE
20810|gene|hbo      ILARAEEELFPDYRGKDADEVADALRHIADEPDVSARYEDHAELDALDEATRAGPELDAG
4022|gene|nph       ALEAA-EPLLEQYRDQPAGEVADAL------------------------DIEPETDIDIG
2859|gene|hut       VLENA-TPLFDRYKEQARTDIVSAL-----------------------------------
1844|gene|hhi       VLDNA-QPLFNTYKSRETPDIVSAL-----------------------------------
11250|gene|hma      VLDNA-QPLFNTYKSRETPDIVSAL-----------------------------------
                     *  .       *.      : .:*                                   

2124|gene|hhi       ATGRCELEIRIVFRTD-----DNT--------------------------------TNDE
978|gene|hla        SS--ATNETDETDETEEGRIVADATPPIEGFEAGVTAEGSFADGSDARDGDRTGDTSDGE
20810|gene|hbo      EDGPSELDAGDDGPSELGAGVDDGPGELEGNDTPALDAGTSDDGTE--EDETTGEVTDGS
4022|gene|nph       QSSETPSRVDDEDTPS-----DDASASADGGEQRITDAETSVPDLD--DIRRTG--TDDP
2859|gene|hut       ----ADVESDDALAED-----DDD-----------VDFGRFVP--------KAG--TDGV
1844|gene|hhi       --------MDDSEESA-----DED----------SIDFGQFVP-------------KAGA
11250|gene|hma      --------MDDSEESA-----DED----------SIDFGQFVP-------------KAGA
                                          :                                 . . 

2124|gene|hhi       DRSRR-------------------------------------------------------
978|gene|hla        NADDTDDPDGGIDFDEPFDEGIDVLDSRPDSGPVPGPNPNPAPDPNPEQADSGVRADADG
20810|gene|hbo      DPEADLRGSDDEDFGIEELLGEDVSEELEEDGWGFGEFENADPEDT--------------
4022|gene|nph       DR----------------------------------------------------------
2859|gene|hut       EGE---------------------------------------------------------
1844|gene|hhi       EADSE-------------------------------------------------------
11250|gene|hma      EADSE-------------------------------------------------------
                    :                                                           

2124|gene|hhi       ------------------------------------------------------------
978|gene|hla        GVTEVEVGVEDAKIDDEDAGDAATRKESGDTESDDEGEGDTATEGEDEDDDGNNADNIDD
20810|gene|hbo      --------VNNDTVSEDTGRGDAARGKDGESDADHESGDYEGDEPSEGGE----------
4022|gene|nph       ------------------------------------------------------------
2859|gene|hut       ------------------------------------------------------------
1844|gene|hhi       ------------------------------------------------------------
11250|gene|hma      ------------------------------------------------------------
                                                                                

2124|gene|hhi       ------------
978|gene|hla        WGFGSVESREER
20810|gene|hbo      ------------
4022|gene|nph       ------------
2859|gene|hut       ------------
1844|gene|hhi       ------------
11250|gene|hma      ------------