HOG Organism Gene ID Name Annotation
aHOG1238 hhi 2003 HAH_2003 hypothetical protein
aHOG1238 hbo HBOR20830 Hbor_20830 hypothetical protein
aHOG1238 hla HLAC0976 Hlac_976 hypothetical protein
aHOG1238 hmu HMUK2140 Hmuk_2140 conserved hypothetical protein
aHOG1238 hut HUTA0731 Huta_0731 conserved hypothetical protein
aHOG1238 hut HUTA2867 Huta_2867 hypothetical protein
aHOG1238 nph NP4018 hypothetical protein
aHOG1238 hma Hma_11420 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


976|hp|hla        ------------------------------------------------------------
4018|hp|nph       ------------------------------------------------------------
2867|hp|hut       MQFAETIVPTPNYSGCKAGRSSAIKSILALRIAITRLIGALGTRIPGGGRVQLPWVAERS
20830|hp|hbo      -------------------------------------MGGGWMTSGRGRETERECRHER-
731|chp|hut       -------------------------------------------MFPQKLSPER-------
2003|hp|hhi       ------------------------------------------------------------
11420|hp|hma      -------------------------------------------MNRRRNETQSTNRRASQ
                                                                              

976|hp|hla        --MWDNGNRAQTPIDFTVGAGVFLLTLAFVIAFVPTLFDPFSAA-ATASPVVSDRVAAGV
4018|hp|nph       -MISVPTDRGQTTLDFAIGTSVFLLATIFVVAYVPTMFDPFAGG-GGSKLVVADHAAATL
2867|hp|hut       ---AVEDRRGQTNLDFILGVTILVVAVVFVWLFLPNLFGPFVDGDTHSDSLAAERAANNL
20830|hp|hbo      ---KQEHERAQTTMDFTVGISIFLLVVVFVVAFVPGIFEPFEGA---DQTQTADRLGTSL
731|chp|hut       ---SSSRDRGQTTLDFAFGVSIFLLVLAFAFTFIPGILQPFAEG-TAAETVGANRAADTL
2003|hp|hhi       ---MGEHRRGQTTLDFAIGMSLFLSVLIFIFLFIPGLLSPFSAG-VQEETVTTDRVADGL
11420|hp|hma      SLWIEEHRRGQTTLDFAIGMSLFLSVLIFIFLFIPGLLSPFSAG-VQEETVTTDRVADGL
                          *.** :** .*  ::: .  *   ::* :: **  .    .   ::. .  :

976|hp|hla        AGDLLAASPAEPGVLSPACTVAFL----SANATLGSEADCHPAIAESPAAHFGIDGDVQV
4018|hp|nph       SGDLLATSTAEPGTLSVGCVAAFF----DA----GPAEFCGT-DFDDEEQMLALDDRN-A
2867|hp|hut       AEDALKTQPGAD-ELDEDCVVAFF----MGS---SSAPGCGF-SGSTLTEQIGLGELHFA
20830|hp|hbo      ASDALG-EPGTPAALNATCTWSFFRQMQTGT---DTTADCGF-DATTDTVAATLGVTD-V
731|chp|hut       AEGTLG-DPATPYVLNTTCTVGFF----DT----GVPSGCRY-TGSTATERLSIGSFQ--
2003|hp|hhi       TMGMLG-SPQQPYVLDEHCTREFF----AGN---APPSGCGYESGGSAEERVGLDPAR-E
11420|hp|hma      TMGMLG-SPQQPYVLEEHCTQEFF----AGN---APPSGCGYNSGGSAEERVGLNPAR-E
                  : . *  ..     *.  *.  *:               *             :.     

976|hp|hla        VIHAPDERNPSTNASTLSIATRHG-RFE--VEPDR----------TTADPSDAAGKDVTV
4018|hp|nph       AVTIHPLDASPTSPATLPETAIDD-SHN--VDSDA--------DLAWTNAPDSQRQDVAV
2867|hp|hut       NVSAEFTNGT--------VLAWHGPGAGGFSDSGTP-------KLSRGGTHGSTSD-VSV
20830|hp|hbo      AVNVTV---------------FDD-GA--VAELDSPDGIAGTKRELRAGPPVPTSRGVAT
731|chp|hut       DVNVTLRGSTSGTDYS--LLCWNG-TA--LTEADSPNCGTGDKRLATGDPIPSVSIPTIT
2003|hp|hhi       NVNVTIRGNATATAASDETLCWDG-ATEELVEASG-SCGT---VLTTGGNPPTNNDASVT
11420|hp|hma      NVNVTIRGNATATAAADETLCWDG-GSEELVEAGT-GCGT---ILTTGGNPPTNNDASVT
                   :                     .       : .              .   .      .

976|hp|hla        SQRLVSIGGTQYRLTVRVW
4018|hp|nph       ATRTVSVAGDQYRMTVEVW
2867|hp|hut       ARRVVSIDGQRAVLVVRVW
20830|hp|hbo      ARRAVLLDDRTRQLVVRVW
731|chp|hut       ARRVVAIDGTTAVIRVVIW
2003|hp|hhi       ALRVVSLNGQDVTVRVVMW
11420|hp|hma      ALRVVSLNGQDVTVRVVMW
                  : * * : .    : * :*