HOG Organism Gene ID Name Annotation
aHOG1235 hhi 5046 nosL nitrous oxide reductase
aHOG1235 hbo HBOR23280 Hbor_23280 predicted lipoprotein involved in nitrous oxide reduction
aHOG1235 hla HLAC1721 Hlac_1721 NosL family protein
aHOG1235 hmu HMUK0347 Hmuk_0347 NosL protein
aHOG1235 hut HUTA2965 Huta_2965 NosL family protein
aHOG1235 nph NP3934 nosL lipoprotein NosL
aHOG1235 hma Hma_7145 nosL NosL protein
MUSCLE (3.6) multiple sequence alignment


1721|gene|hla      -----------MTETEPLSVSRRRLLAGVGAGLSLAAAGCLGD--------ESASITPVS
3934|gene|nph      -----------MSPDQSGSLSRRTVLVSAVAGGIGAVAGCLDG--------DRDGPDPVS
5046|gene|hhi      ------------MSDYAPALTRRHFIVGTATVA--SLSGCLGT---------SEEVEPVA
7145|gene|hma      MNHLVSFSVASSMSEHATGLTRRCFLAGTGTVAVVSLSGCLGN---------SEEIDPVS
23280|hp|hbo       -------MCDQRPADDGNTFRRRHFLLASAGVGAASLAGCLGGNEGGGDGGQTTAPTAVT
2965|gene|hut      ------------------------------------MAGCLSG----------PTPDPVT
                                                        :***.               .*:

1721|gene|hla      LDGERACDQCGMIIADHPGPVGQIHFEDDEP-----EG-GRPGQFCSSTCTYTYRFDAED
3934|gene|nph      LDDGQACDTCDMLIEMHPGPVGQAFYGDDAPRSLPDDRDDGAAWFCSSTCAYQFILEEEE
5046|gene|hhi      IESGQNCDQCGMVIDQHPGPVGQTYYQDNTP-----EGHDPPARFCSTTCTYRHRFAKEQ
7145|gene|hma      IESGQNCDQCGMVIDQHPGPVGQTYYQDNTP-----EGHDPPARFCSTTCTYRHRFAKEQ
23280|hp|hbo       IPEGSTCEVCGMNIRQNPGPITEIFYQDKQP-----NGHDNPARFDSVWEAYQYEFEKDD
2965|gene|hut      LGSDDVCDVCGMIIPQHPGPTTEVFYRNNDP-----SGHDNPARFDSTWEAFQYDFERRD
                   :     *: *.* *  :***  : .: :. *     .  . ...* *   :: . :   :

1721|gene|hla      AGRTVRAAFLTDYSLVDQEVFQEGSDTMFSSHVEREAFSRMIDLTVVARSEVVGAMGPEL
3934|gene|nph      RGHEPAISYGTDYSTVDYTLRDDNGVTVISAHLEADAFADLHDLTFVADSDAEGAMGGSL
5046|gene|hhi      SGWTPAETFLTDYSATDYDVRTDGGKTIISRHLESEAFASTEELTVVANSEIEGSMGTAI
7145|gene|hma      SGWTPAETFLTDYSTTDYEIRTDGGKTIISRHLEAEAFAPVGQLTVVANSDVEGAMGTAI
23280|hp|hbo       AGWTDVAFYVTDYSSVEYRTFEEGGDTFISSNYESSAFVPATEVTYVVDSSVKGAMGRDL
2965|gene|hut      RGWTRAAFYVTDYSSVDYEIRTDAGTTFISTHPEAAAFADASAVTFVVGSSVEGAMGRDL
                    *.     : **** .:     : . *.:* : *  **     :* *. *.  *:**  :

1721|gene|hla      ISFGEEEDVESFVEEYGGEPMAAEDVDRGTLEAL----
3934|gene|nph      IGFSDPDDAEAFQSEHGGELLAHDEVTREVLTGLGMGM
5046|gene|hhi      VPFSDSADAESFAEEYGGQTLPAEDITRELVGGM----
7145|gene|hma      VPFSDSADAESFAEEYGGQTLPAEDISRELVGGM----
23280|hp|hbo       VPFSKASDAESFQSEFGGSLATHDEVTPEVIAGIGQ--
2965|gene|hut      IAFSSDDDATAFADEYGGSTAQFADVTRSMIGSLAQT-
                   : *..  *. :* .*.**.     ::    : .: