HOG Organism Gene ID Name Annotation
aHOG1234 hhi 5044 HAH_5044 hypothetical protein
aHOG1234 hbo HBOR23310 Hbor_23310 hypothetical protein
aHOG1234 hla HLAC1724 Hlac_1724 copper ABC transporter permease
aHOG1234 hmu HMUK0349 Hmuk_0349 conserved hypothetical protein
aHOG1234 hut HUTA2968 Huta_2968 copper ABC transporter permease
aHOG1234 nph NP3920 abc11p copper ABC transporter permease
aHOG1234 nph NP3926 abc12p copper ABC transporter permease
aHOG1234 hma Hma_7148 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3926|gene|nph      MSTPTDTANTAVSEAETRPETPTTAAILRALVSRELSTAVLRRSTLLLWVGFLGVLLGIA
1724|gene|hla      --------------------MSGPLTGVATVFRRELATVVRTPGYGVLAVGLLVAVGGLL
3920|gene|nph      -------------------MSRHRA--FGAVAWRELQTVVRTRTYALLSVGLAVVFVQLL
5044|hp|hhi        -------------------MIDGNR--FWTVFVREVRSAVRTRTYLALGLVTGIVLFGLA
7148|hp|hma        -------------------MTEGNW--FWTVFVREVRSAVRTRTYLALGLVTGIVLFGLA
2968|gene|hut      --------------------MNESWERTVAVAQRAFDATLRSRALLAVAAGYAFVVLALA
23310|hp|hbo       -------------------MNRDSFDYLFVVATRELRTVARTPALLALAAAFTVSIVGVA
                                                .:  * . :.        :       .  : 

3926|gene|nph      WFGGGMQVGYIATVIDLLTPLELLVPVIAMALGYRAILSDERRGELDVLKTYPVASWQVV
1724|gene|hla      AAGGGGATGFVPAVVDLLLPTEALVPLVGVVLGYRALLSDGASGELAVIRTYPVRVSEYV
3920|gene|nph      RSGGGVEMGYVPAAVDLLLALELLVPLVAVALGYRAFTGD--NDDLSVLRTYPVSRSSLV
5044|hp|hhi        YAGGGPAGGYVPTVVDTLVAVEVLVPTLAFAVGYRAIADPAVRGELDILDTYPLSTWSYV
7148|hp|hma        YAGGGPAGGYVPTVVDTLVAVEVLVPTLAFAVGYRAIADPATRGELDILDTYPLSTWSYV
2968|gene|hut      WTTRGS--GYLSLSLSVLTPLEVLVPVVAFAVGYRSILDDRLRGELAVFRTYPLSARSYV
23310|hp|hbo       WAGSGGGGGFVPLTLDLLTFVEVLVPLLAFAFGYRTVVEDRLTGELDVLRTYDVSRIAYV
                       *   *::.  :. *   * *** :....***:.      .:* :: ** :     *

3926|gene|nph      AGVYVGRAVGLVALVGSSLLFLLYPIFLTDAHQSLFYATHTGADSVWLYLRFVVLTVGFA
1724|gene|hla      AGVLLARTVALVAVVGVPYAVVGAGVWLTVAPDTGIFATHAGIDSPVLYLRFLAFVLLLG
3920|gene|nph      AGVFVGRFLGLAAIVGAPLLLVAGMVARAGGPTSRVFATHRGVDSPVLFIRFIALTLLFG
5044|hp|hhi        GGVYAGRALLLLTIVVVPLLALGVNVATTAGPETTVFASHRGVDSPFLFIRFVALTVLYA
7148|hp|hma        GGVYAGRALLLLTIVVVPLLALGINVATTAGPETTVFASHRGVDSPFLFIRFIALTVLYA
2968|gene|hut      LGVFLGRLATVLMVVLVPLLIAGGSVLAFREESISVLATHATADSPLVYLRLVVLTAVFA
23310|hp|hbo       GGVYVGRGVALVATVVLALVLGGALVPLLTADVPTFLAINTAADSALRFVRFVVLAAAFT
                    **  .*   :   *  .       :         . * :   **   ::*::.:.    

3926|gene|nph      LVLLAVAIAISSLVGSTRSAVTAAGLGLFVLLFGADLALVYGLSRGFVDPSSLASSLAIS
1724|gene|hla      AAYVSLAAAVSALAASRRSAIALGVLALVAGVLGGDLLLLRSLGGGAS-PATISGSLALA
3920|gene|nph      AVVLAMAMAVSVIVRSGRAALVLALAVLVVVVAGGDLLALAGLSAGIIGDDMLASVLGAS
5044|hp|hhi        LTSLTIAFLLSALARSRGRALVLALAGLLVLTVGSDLAVFAALDTGVT-TGTLGGALAMT
7148|hp|hma        LSSLTIAFLLSALAGSRGRALVLALAGLLVLTVGSDLAVFAALDTGVT-TGTLGGALAMT
2968|gene|hut      PVALAVAIAVSAIARTTRNAIGLAIGGVVILVVGLDLGFVAGLAGGVVPPEALSTLSAVS
23310|hp|hbo       LVALAATLAVSAAARTVRTAFALAAVLAALFVLGIDTTLLAGLAAGVVPAEGIAGLLALS
                      :: :  :*  . :   *.  .         * *   . .*  *      :.   . :

3926|gene|nph      PLSAYRSLVIETTVTV-------TAGTGPQTASPVAAAIGLLA--WGVGSLAVAAAAIRR
1724|gene|hla      PNGAFRGLVFEHVIG--------VAFAPEGGFVSTNRAVGSLVGWALLGAGLAGAALAYG
3920|gene|nph      PNSAYRGLVLDLVVGVATDQAGAIAVPAAVAGLATWLGGSLLIVAA--GLHRQPASRLRN
5044|hp|hhi        PAGAYRGLVFDQVLY--------VAVPGRSAFVPTWVAALSLLFWW--GLTFVGAMLATD
7148|hp|hma        PAGAYRGLVFDQVLY--------VAVPGRSAFVPTWVATLSLLFWW--GLTFVGAMLATD
2968|gene|hut      PLSAFRGLVLEVAIGP-------VAGDTIAGGVEPLAALLGLVG-WTAGALAVAIHWVYR
23310|hp|hbo       PNSAFRGLVLSSAVGV-------VGGAEVTAGSPLWNVIGLLV--WWVGSLGIAVWRVWP
                   * .*:*.**:. .:          .                *      *           

3926|gene|nph      -----------------
1724|gene|hla      RRVDALLERVRSRIAG-
3920|gene|nph      -AIRSAIERARTTIVGR
5044|hp|hhi        -AA--------------
7148|hp|hma        -AA--------------
2968|gene|hut      -PGPP------------
23310|hp|hbo       -AVEDVTN---------