HOG Organism Gene ID Name Annotation
aHOG1233 hhi 5043 HAH_5043 ABC transporter ATP-binding protein
aHOG1233 hbo HBOR23300 Hbor_23300 ABC-type multidrug transport system, ATPase component
aHOG1233 hla HLAC1723 Hlac_1723 ABC transporter related
aHOG1233 hmu HMUK0350 Hmuk_0350 ABC transporter related
aHOG1233 hut HUTA2967 Huta_2967 ABC transporter related
aHOG1233 nph NP3918 abc11a copper ABC transporter ATP-binding protein
aHOG1233 nph NP3924 abc12a copper ABC transporter ATP-binding protein
aHOG1233 hma Hma_7149 drrA-2 ABC transporter ATP-binding protein
MUSCLE (3.6) multiple sequence alignment


23300|gene|hbo      MTNSVKDEYAQNDTAASDGESGSNDERGSDAGHVEATNATTALRANNISRSFGDVSVFSN
2967|gene|hut       --------------MTGDDSRNGKEVADAQTADDEAASGDSVLTLEAVRQSFGDVSVLEG
1723|gene|hla       -----------------------------MPD-------ETVAALSDVTRTYGGVPVLDS
5043|gene|hhi       -----------------------------MTG-------ETYLTADEVTKKYGDVTAVSE
7149|gene|hma       -----------------------------MTG-------ETYLTANEITKTYGDVTAVSE
3918|gene|nph       -----------------------------MSDGPETPTDGPVLTADGVSKSFGPVDVLSD
3924|gene|nph       -----------------------------MTDE------TPILRISDLEHAYGSIDVLDG
                                                  .         .    . : . :* : ... 

23300|gene|hbo      LSFGVERGEVFSLVGPNGSGKSTLLEVLAGVRPTSTGSVTVSQREDGVREVGYLPQRPSF
2967|gene|hut       VSLDVRAESVTCLLGPNGSGKSTLLSIAAGLRTPDEGTVT--GEIDAARDVGYLPQRPAF
1723|gene|hla       VSLTVEPG-LTAVIGPNGSGKSTLLGVLVGATAPTAGEVRHPGA-TGPKPIGYLPQRVPF
5043|gene|hhi       VSLDVPSDAVTGFIGPNGSGKSTLLRVLLGVERPTSGTVSYSGP-EAERQLGYLPQRPTF
7149|gene|hma       VSLDVPSDAVTGFIGPNGSGKTTLLRILLGVERPTSGTVSYSGP-DAERQLGYLPQRPTF
3918|gene|nph       ISCVIPAEEVVAIIGPNGSGKTTLLRTLVGDLRPTAGEVTYHGP-SVDRPIGYLPQRATF
3924|gene|nph       VSLDIDAGEVTAIIGPNGSGKTTLIRGIVGLHEPTSGTVEYTGP-ETTRPIGYLQQRPAF
                    :*  :    :  .:*******:**:    *   .  * *         . :*** ** .*

23300|gene|hbo      RDGFTARDTLDFYARFLDGVGDDEVTETLERVGLSGVADRSVGSLSGGMTRLLGLGQAVL
2967|gene|hut       RPHFTVAETIGFYGSLVPTPIDE--AATLERVGLAAVADRRVEHLSGGMVRLLGLAQATV
1723|gene|hla       REGFTARETLAFYARLVGD--DP--DAALDRVGLGDAGDRRVEALSGGMRRLLGIAQAVL
5043|gene|hhi       RPGFSVRETAAFYADLVDD--DP--DRLLERVGLEEVAGRPVSGLSGGMTRLLGIAQALA
7149|gene|hma       RPGFSVRETAAFYADLVDD--DP--DRLLERVGLEKVASRPVSGLSGGMTRLLGIAQALA
3918|gene|nph       RSGFSCAETLSFYGSFVDGP-DP--ATLLERVGLEGAADRNVEALSGGMRRLLGIAQAMV
3924|gene|nph       RPGETVEQTLSFYASLVGET-DADVADRLEQVGLSAASDRDVDALSGGMTRLVGIAQATI
                    *   :  :*  **. ::    *      *:.***  ...* *  ***** **:*:.**  

23300|gene|hbo      GDPAVLVLDEPGSGLDPAMVERLFGIVGELAQSGSAVVVASHELPAIETYADTVAVLDGG
2967|gene|hut       GSPPVVVLDEPASGLDPQIRHRIADVIADLAADGAAVLMATHDLDAAERIADQVRILDDG
1723|gene|hla       GDPSLVVLDEPASGLDPGMRERAFRAAADQADGDTAVVVSSHALDLVDDHADRVVVLRRG
5043|gene|hhi       GDPPIVMLDEPASGLDPAMSRLIFDIVESIADAGRAVVLCSHELPLVEETADRLVVLESG
7149|gene|hma       GDPPIVMLDEPASGLDPAMSRLIFDIIESIADAGRAVVLCSHELPLVEETADRLVVLESG
3918|gene|nph       GDPPLVVLDEPASGLDPNMSASVFETAGEMAGGGTTVLLSSHDMSLVEAVADTVLVVSQG
3924|gene|nph       GSPPVVVLDEPASGLDPGMSVRIFEVAAELADAGTAVLLTSHDLSLVERTADHVALLDAG
                    *.*.:::****.***** :         . *  . :*:: :* :   :  ** : ::  *

23300|gene|hbo      EFVARGTPESLLSQAEADTLPDAFLRLV-----------------GAEAGSVTVRADA--
2967|gene|hut       EFVAGGSPSEIQSETAAESLGGAIDALI---------------DREDAIGVRAGTGDR--
1723|gene|hla       EVAAEGPLDRLLDEHGVANASELYRVVIGELGAPAGDEGEGPDDEDESDGESDDGDDEGE
5043|gene|hhi       RLVRTGSVDSLREQTG-GPLHETFTALL---------------EQDRATIAAPEGTQP--
7149|gene|hma       RLVRTGSVESFREQTG-GPLHETFTALL---------------EQDRATIAAPEGEQA--
3918|gene|nph       DVVASGAVAELYDRFEVSSLRGVIGSVV-----------------DDSDRVAVLGGDA--
3924|gene|nph       EIAESGPPEAIRETVGADSLLSAFEDAI-----------------TGDAGTVTVRGEP--
                     ..  *.   : .              :                            :   

23300|gene|hbo      -----------------------------------------------------------T
2967|gene|hut       ------------------------------------------------------------
1723|gene|hla       SDGDDEGESDGDDEGESDGDDEGESDGDDEGESDGDDEGESDGDDEGESDGDEPEPTVHV
5043|gene|hhi       ------------------------------------------------------------
7149|gene|hma       ------------------------------------------------------------
3918|gene|nph       ------------------------------------------------------------
3924|gene|nph       ------------------------------------------------------------
                                                                                

23300|gene|hbo      SREATR
2967|gene|hut       -----R
1723|gene|hla       TGVSDR
5043|gene|hhi       ------
7149|gene|hma       ------
3918|gene|nph       ------
3924|gene|nph       ------