HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0123COG1562KOG1459arCOG02936Phytoene/squalene synthetasephytoene synthase

HOG Organism Gene ID Name Annotation
cHOG0123 nrc1 VNG1458 crtB1 phytoene synthase
cHOG0123 nrc1 VNG1680 crtB2 phytoene synthase
cHOG0123 hmu HMUK0276 Hmuk_0276 Squalene/phytoene synthase( EC:2.5.1.32 )
cHOG0123 hma RRNAC2069 crtB phytoene synthase
cHOG0123 hwa HQ2860A crtB geranylgeranyl-diphosphate geranylgeranyltransferase (phytoene synthase)
cHOG0123 hla HLAC2476 Hlac_2476 Squalene/phytoene synthase
cHOG0123 hbo HBOR10680 Hbor_10680 phytoene synthase( EC:2.5.1.32 )
cHOG0123 hut HUTA0143 Huta_0143 Squalene/phytoene synthase
cHOG0123 hvo HVO_2524 HVO_2524 crtB phytoene synthase
cHOG0123 nph NP4770A crtB geranylgeranyl-diphosphate geranylgeranyltransferase (phytoene synthase)
cHOG0123 hhi 2563 crtB phytoene synthase
MUSCLE (3.6) multiple sequence alignment


1458|gene|nrc1      MVSPEHLRRSKAVQRRTGRTFHIATRFLPERVRYPTYVLYAFFRLTDEIVDDEAPGPPDE
4770|gene|nph       MVDSTQLAESKSIHRETGKTFYYATRLLPERVRHPTYVLYAFFRLADEVVDDPGALSPDE
1680|gene|nrc1      MVEKTHITTSKAIQRRTGKTFHLATRLLPTRVRHATYVLYAFFRVADDVVDTTADRDPGV
2476|gene|hla       MVDKTQVARGKRIQRRTGKTFHVATRLLPERIRHPTYVLYGFFRVADEVVDAAETAPPDE
2524|gene|hvo       MLNESQVEAGKDIQQRTGKTFYFATRLLPERVRHATYVLYAFFRVADEVVDAEETAPPAQ
2860|gene|hwa       MVRHEQIERSKAIQKRTGKTFHLATRVLPERVRHATYVLYAFFRVADEVVDATDAAPPPQ
10680|gene|hbo      MVKQEQIQQSKAIQRKTGKTFHLATRVLPERVRHATYVLYAFFRVADEVVDAEETAEPSA
143|gene|hut        -MIGRSVKTSKAIHRRTGKTFYIATRLLPERVREATYALYAFFRIADDVVDRPDPPDAET
12069|gene|hma      -MHSDNIQTSKSIQQETGRTFHLATRLLPERIRHPTYVMYAFFRVADEVVDQTDGPPPTV
2563|gene|hhi       -MHSDNIQTSKSIQQETGRTFHLATRLLPERIRHPTYVMYAFFRVADEVVDQTDGPPPTV
                     :    :  .* ::. **.**: ***.** *:* .**.:*.***::*::**      .  

1458|gene|nrc1      QRRRLAHVRAAALGDRD-------PDDPVLAAFAALREDHDIPREEVTTFIDAMQQDVDT
4770|gene|nph       QRQELLDIREAALGRTE-------PDDPVLEAFSEVRRRHDIPDEEVEVFIDAMLTDIEK
1680|gene|nrc1      QREELEGIRAAALGARDPES--VAADTEVLAAFRELATRHGISDEDIHTFIDAMQADLEK
2476|gene|hla       QRAELDRLRRAALAERD-------TDDPVLEAFAAVCDEHEIPDEDVHAFVDAMASDIET
2524|gene|hvo       QRDRLERLRAEALGVVE-------TDDPVLSAFAELRARYGIDPDDVNVFIDAMESDIEK
2860|gene|hwa       QRERLAELRRQALGKES-------TDDPVLSAFAELCESYEIPNEDVNVFIDAMLADVDT
10680|gene|hbo      QRERLEQLRAQALGRDE-------TDDPVLSAFAELREQYDIADEDVNVFIDAMRSDITK
143|gene|hut        QRRHLEAIRAAANGEQIQRGVLSETDREVLETFRSLAEEADIDPAEIDVFIDAMAQDIDH
12069|gene|hma      QHEQLEVIREAALGNIDPE---ETDHEAVMAAFQDLADRHDISEETINVFIDAMEMDIAQ
2563|gene|hhi       QHEQLEVIREAALGNVDPA---ETDHEAVMAAFQDLAERHDISEETINVFIDAMEMDIAQ
                    *.  *  :*  * .              *: :*  :     *    : .*:***  *:  

1458|gene|nrc1      ARYRSHDDLAEYLRGSSVAVGYMMLSIMDAPEPE--RARPHAASLGEAFQLTNFLRDVRE
4770|gene|nph       SRYETYEELEAYMQGSASAVGVMMTMLMGTEDTD--AAVPRARALGEAFQLTNFLRDIGE
1680|gene|nrc1      TRYESHAELEEYMRGSAVAVGYMMMDVMEVAEPE--TAAPHAAALAEAFQLSNFLRDVAE
2476|gene|hla       DRYETYDQLESYMDGSAAAVGRMMTAIMELDEEAEVKALPHATKLGEAFQMTNFIRDVRE
2524|gene|hvo       DRYETYAELETYMDGSASAVGRMMTAVMRPDDPE--AALPHATALGQAFQMSNFLRDVGE
2860|gene|hwa       DQYETYDDLETYMDGSAAAVGRMMTAIMDTENAE--TALPHATALGEAFQMSNFLRDVGE
10680|gene|hbo      SRYETYDELETYMDGSAAAVGRMMTDIMQTPNAE--KARPHATALGEAFQMSNFLRDVRE
143|gene|hut        SGYETYEELRGYMRGSAAAVGNMMLSVMDPPESD--RATPHARSLAEAFQLTNFVRDVRE
12069|gene|hma      ARYETFEDLREYMGGSAVAVGHMMTEVMDPPQKE--EALPHATALAEAFQLSNFLRDVRE
2563|gene|hhi       ARYETFEDLREYMGGSAVAVGHMMTEVMDPPQKA--EALPHATALAEAFQLSNFLRDVRE
                      * :. :*  *: **: *** **  :*   :     * *.*  *.:***::**:**: *

1458|gene|nrc1      DVLDYDRIYLPSQTLAAHGASHDDIAALSATPQVRDAIRAELDRTERLYRHGVAGIEHLP
4770|gene|nph       DIEERNRIYLPQETLDAYDVDPADIEAHRFTDELGDAIEHELERAERRYREGVAGIKYLP
1680|gene|nrc1      DVHEYDRVYLPAESRADHGVTVEQLRARTVDAGFREAMREELAYTERKYRTGVAGIEYLP
2476|gene|hla       DVAERDRVYLPLETLRRHGVSEDQILNLEFDDDVAAAIREELVRTERLYEEGVAGIKYLP
2524|gene|hvo       DVVERDRVYLPQTTLDRHGVDTEQILDLDFDERVADVMRDELRRTESLYRDGVAGIEYLP
2860|gene|hwa       DVKERDRVYLPQETLRQYDVSTAQILNLEFDENVRAVIQHEQQRTEALYREGVKGIQYLP
10680|gene|hbo      DIVERDRVYLPQETLEKHGVTEEQLQSFRCDENFRAVMREEMRRTEALYREGVHGIQYLP
143|gene|hut        DISEYDRVYLPDETLDRHDVTETQLRRGDMTDDVAAVIRTELHRTESLYRHGVAGIRYLP
12069|gene|hma      DIHDYGRVYLPQETLERHGVTEEQLADAEVDDAFRAVMQEELARTDELYREGVAGIRYLP
2563|gene|hhi       DIHDYGRVYLPQETLDRHGVTEEQLADAEVDDAFRAVMQEELARTDELYREGVAGIRYLP
                    *: : .*:***  :   :..   ::        .  .:  *   ::  *  ** ** :**

1458|gene|nrc1      ADCQFPVLAAAVMYADQHRLIRAQDCDVLSQRPTLTLRRRLSVVARTWLRWRVSDDPTAV
4770|gene|nph       VDCQLPVLTAAVLYADHHRLIRDHDLDTVTQTPSLGTLRKLALVARTRWHWAWTKDPEAV
1680|gene|nrc1      EDCQFAVLVSAVLYADHHRAIRERDCDVLTATPSLSTPRKLWLVAKTRALWALNSSPEAV
2476|gene|hla       EDCQLAVLLAAVLYADHHRLIRDLGYDTVSTTPELSFVRKISLLVRTRWKWQWNRDPEAV
2524|gene|hvo       ADCQFPVLLSAVLYADHHRSIRKLDYDTLTTTPELGFGRKLTLLAKTAAYWAVWRDPVAV
2860|gene|hwa       EDCQLAVLLAAVLYADHHRAIERVDYDVLSRTPSLSTPRKLWLLLKTRMYWTLTPDPVTV
10680|gene|hbo      EDCQFAVLLAAVLYADHHRAIRKRAYDVLSVTPSLSTARKLALLVKTRAYWAVEKDPETV
143|gene|hut        EDCQFAVLLAAVLYADHHRQIRHLEYDVLNGDASLSMTRRLWLLARTWYHWRRTHDPEAA
12069|gene|hma      EDCQFGVLLAAVLYADHHRLIRDRGYDVLTETPDLTRRRRLWLLARTWWHWRRNGDPEAT
2563|gene|hhi       EDCQFGVLLAAVLYADHHRLIRDRGYDVLTETPELTRRRRLWLLARTWWHWRRNGDPEAT
                     ***: ** :**:***:** *     *.:.  . *   *.: :: .*   *    .* :.

1458|gene|nrc1      FHAVTGI---------GEPDAGGVPEQSFAV------------RESQPTR------AD
4770|gene|nph       FSRVSPI---------SMGEETAIPSERP--------------RDPLPMG--------
1680|gene|nrc1      FYRATGL---------AETGDSRRRHGDP---------------QPTPSR--------
2476|gene|hla       FYEMC-----------GGFDAAREHREHGSH-------------GPGIAQ------SD
2524|gene|hvo       FKAVSVVPYPEDDDLAAEFGPGSTPVEHSRR----------SGRVSGWLRSLSRWGSD
2860|gene|hwa       FRRVSVVPYPDEYD-DVDETDSDARHDREPNRGWSIGTEFVTQRFSNLVRHFTR--GE
10680|gene|hbo      FRKVSVVPYPSSEDH-SHHDPGHSGASRSPG--------LLGGRLSSWVRSFTR--GE
143|gene|hut        FYAASAI---------SEDGPASDHPDPQ--------------LQPDRVI--------
12069|gene|hma      FYTVSAV---------SERGPGETPTDTHSH------------GQPTWRG--------
2563|gene|hhi       FYTVSAV---------SERGPGETPTDAHGH------------GQPAWRG--------
                    *                                            .