HOG Organism Gene ID Name Annotation
aHOG1228 hhi 1156 yajO putative NAD(P)H-dependent xylose reductase
aHOG1228 hbo HBOR19930 Hbor_19930 predicted oxidoreductase, aryl-alcohol dehydrogenase like protein
aHOG1228 hla HLAC1533 Hlac_1533 aldo/keto reductase
aHOG1228 hla HLAC2362 Hlac_2362 aldo/keto reductase
aHOG1228 hmu HMUK1164 Hmuk_1164 aldo/keto reductase
aHOG1228 hmu HMUK2706 Hmuk_2706 aldo/keto reductase
aHOG1228 hut HUTA1418 Huta_1418 aldo/keto reductase
aHOG1228 hut HUTA2875 Huta_2875 aldo/keto reductase
aHOG1228 hut HUTA2991 Huta_2991 aldo/keto reductase
aHOG1228 nph NP2796 abc23u ABC transporter substrate-binding protein
aHOG1228 hma Hma_10482 yajO putative NAD(P)H-dependent xylose reductase
MUSCLE (3.6) multiple sequence alignment


1418|gene|hut       ---MEYTTLGSTGMEVSQLCLGAMSFGSEE--PWMLGKEESREIIERAIDLGVNFFDTAN
2875|gene|hut       ---MEYTTLGSTGMEVSKIALGCMSFGSQD--DWMLDAEEGRELVERAIDLGVNFFDTAN
2796|gene|nph       ---MEYTTLGATGIEVSRICLGCMSFGDDDWREWVRGEEFGHELVERALDLGINFFDTAN
1533|gene|hla       ---MEYTTLGDTGATVSRLALGCMSFGSEH--EWMLDEEEGRELIERAIDLGITFFDTAN
2991|gene|hut       ---MEYTTLGSTGMEVSRICLGCMSFGSSDWREWVLDEEGSREIIERAIDLGINFFDTAN
1156|gene|hhi       MGNMEYTTLGSTGMEVSRLCLGCMSFGTSEWRDWVLDEDESREVIERAIDLGINFFDSAN
10482|gene|hma      ---MEYTTLGSTGMEVSRLCLGCMSFGTSEWRDWVLDEDESREVIERAIDLGINFFDSAN
2362|gene|hla       ---MEYTTLGSTGTTVSKICLGCMSFGDSDWREWVLDEEEGKAIVERALELGVNFFDTAN
19930|hp|hbo        ---MEYTTLGDTGMEVSRICLGCMSFGTSDWREWVVDEEAGKELVDRAIELGINFFDTAN
                       ******* **  **.:.**.**** .    *: . : .. :::**::**:.***:**

1418|gene|hut       AYSAGESEEILGDVLSEYDRDEQVVATKVRFPVGEDTPNASGLSRKTIQQELDASLDRLG
2875|gene|hut       TYSSGESEEILGDVLAEYDRDEQVVATKVRFSGATEHRNAEGLSRKTIEQELEHSLDRLG
2796|gene|nph       MYSRGESERILGDALDGH-REESVVATKVYFPMRDGDPNSGGLSRKTVEQELSASLDRLG
1533|gene|hla       VYSNGESEAILGDVLAEYDRDRFTVATKVYGEMDESNPNSGGLSRKAIEQELENSLDRLG
2991|gene|hut       MYSLGESERVLGNVLSEYDRDEQVVATKGFFQMDDDNPNSGGLSRKAIEQELANSLDRLG
1156|gene|hhi       MYSMGESERVLGTVLDDYDRDSQVVATKGYFQMDEDNPNAGGLSRKAIEQELSNSLSRLG
10482|gene|hma      MYSMGESERVLGTVLDDYDRDGQVVATKGYFQMDEDNPNSGGLSRKAIEQELSNSLSRLG
2362|gene|hla       MYSNGESERVLGEALEGH-REESVVATKAYFQMAESNPNSGGLSRKAIEQELEHSLDRLG
19930|hp|hbo        MYSEGESERILGEALEGR-RDEAVVATKLYFQMDDSDPNSGGLSRKAIEQELDNSLDRLG
                     ** **** :** .*    *:  .****          *: *****:::***  **.***

1418|gene|hut       MDTIDLYQTHRVDPNTPPETTLRALSDAVRAGKVRHVGTSSMFAHQLSDRLRTSEREDLV
2875|gene|hut       MDTVDLYQIHRWDYDTPIETTLRALDDAVRRGKVRHIGASSMWAHQFQEALHVSDREGLA
2796|gene|nph       MDTVDLYQIHRWDYDTPIAQTLRAMTDAVQRGQVRHIGASSMWTHQLAEALHTSDREGLE
1533|gene|hla       MDTVDLYQIHRWDYDTPIEETLSALDDAVRRGKVRYLGASSMWAHQFAEALHTSDREGYE
2991|gene|hut       METVDLYQTHRWDYDTPIDETLAALDAAVRRGQARHVGTSSMWAHQFADALATSEREGLE
1156|gene|hhi       MDTVDLYQIHRWDYDTPIEQTLRALDDAVRRGQARYVGASSMWTHQFADALRTSERERLE
10482|gene|hma      MDTVDLYQTHRWDYDTPIEQTLRALDDAVRRGQARHVGASSMWTHQFADALRTSEREGLE
2362|gene|hla       METIDLYQLHRWDDDTPIEETLAALDDAVRRGKVRHVGASSMWAHQFAEALHTSDREGYE
19930|hp|hbo        MDTVDLLQIHRWDYDTPIETTLRALDDAVRREKVRYLGASSMWAHQFAEALHTSDRLGFD
                    *:*:** * ** * :**   ** *:  **.  :.*::*:***::**: : * .*:*    

1418|gene|hut       SYETMQNHYHLAYREEEREMLPLTEKEDMGVIPWGPLGQGFLTRPIDELESTARGDPENF
2875|gene|hut       RFETMQNLYHLTYREEEREMYPVCEKEDIGVLPWSPLAAGYLTRPHDEFTATTRGE-HEL
2796|gene|nph       RFATMQNHYNLAYREEEREMLPFCEKERLGVMPWSPMARGYLTRPHEEYMSTKRAETDDY
1533|gene|hla       RFVTMQNLYNLAYREEEREMVPLCQREGIGMLPWSPLGAGYLTRPYEQDDATTRGE-HET
2991|gene|hut       RFQTMQNHYNLLYREEEREMLPLCEREGVGVIPWSPLARGYLTRPHEEFDATTRGETDDY
1156|gene|hhi       RFETMQNHYNLLYREEEREMLPLCEKENVGVMPWSPLARGYLTRPHEQVEETVRGETDDY
10482|gene|hma      RFETMQNHYNLLYREEEREMLPLCDKENVGVIPWSPLARGYLTRPHEQVEETVRGETDDY
2362|gene|hla       RFATMQNHYNLAYREEERETLPLCQKEGIGVMPWSPLARGYLTRPHEDVDATLRGETEEH
19930|hp|hbo        RFVTMQNHYNLLYREEEREMLPLCEKENVGVIPWSPLARGWVARPHQEARSTERGETDEL
                     : **** *:* *******  *. :.* :*::**.*:. *:::** ::   * *.:  : 

1418|gene|hut       HNPTDEYTRG-GGREINERVEELADDYGVTMAQIALAWQYQNEYVTAPIVGTTSVEHLED
2875|gene|hut       DYGT-PYHEGPGSEEINHRVAELAADYGVTMAQIALAWHFQNDHVDAPIVGTSSIDHLED
2796|gene|nph       AQEH-PYADN-GGREINERVQELAADKGVSMAQIALSWVLHKEWVDAPIVGASKLSHLED
1533|gene|hla       ALGR-PYREG-GGEEINRRIEELADEKDVKMAQIALRWVAGKEVVDAPIVGTSSVEHLED
2991|gene|hut       AREH-PYFEG-GGREINERVAELAADYGVTMAQIALAWLLHQDAVDAPIVGTTSVEHLED
1156|gene|hhi       AREH-PYYEG-NGREVNERVQELADEYDASMAQIALAWVLDKELVDAPIIGTSSLEHLEE
10482|gene|hma      AREH-PYYEG-NGREVNERVQELADEYDASMAQIALAWVLDKEWVDAPIIGTSSLEHLEE
2362|gene|hla       LYEH-PYREG-GGLAVNERVAELADEKGVKMAQIALAWLFHKEWVDTPIVGTTSVEHLED
19930|hp|hbo        AHGH-PYLEG-GGREINERVQQLADEKGVKMAQIGLAWLFHKDWVDAPIVGTTSIEHLED
                          *  . ..  :* *: :** : ...****.* *   :: * :**:*::.:.***:

1418|gene|hut       AVEAMEIDLSDSDVEYLEAPYEPQPIVGHE
2875|gene|hut       AVAALDISLSASDVEYLEEPYEPVAVFGFE
2796|gene|nph       AVEALEIDLSDSDLAYLEAPYEPVPVSGHD
1533|gene|hla       AVEALDVDLSDSDVEWLEEPYEAVRVSGHE
2991|gene|hut       AVEALEIDLSESDQAYLEEPYEPVPVSGHE
1156|gene|hhi       AVAALEIDLSASDVEWLEEPYEPVRVSGHE
10482|gene|hma      AVAALEIDLSESDVEWLEAPYEPVRVSGHE
2362|gene|hla       AVEALDIDLSKSDMEWLEEPYEPVRVSGHE
19930|hp|hbo        AVEALDISLSDSDIDYLEEPYEPVRVSGHD
                    ** *:::.** **  :** ***.  : *.: