HOG Organism Gene ID Name Annotation
aHOG1223 hhi 5150 HAH_5150 hypothetical protein
aHOG1223 hbo HBOR15180 Hbor_15180 uncharacterized conserved protein
aHOG1223 hla HLAC2668 Hlac_2668 protein of unknown function DUF162
aHOG1223 hut HUTA0361 Huta_0361 protein of unknown function DUF162
aHOG1223 nph NP1724 hypothetical protein
aHOG1223 nrc1 VNG6381 vng6381 no entry
aHOG1223 hma Hma_7018 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


361|hp|hut         MAVCSRLTPMSST-----QTESPVERFVTSLEELDVTWTRTDADAVESTVAELLDEPAVG
1724|hp|nph        ------------------MPASTIETFERAVGRTADGCHRTDTETFEETLSEVVETPAVG
5150|hp|hhi        -------------------MKSKRASFEDALEALGVTVSSTAESDLEAAVTEAVTEPAVG
7018|hp|hma        -------------------MESKRASFEGALEALGVTVSSTSESELEAAVTEAVTEPAVG
2668|gene|hla      ------------------MSVEPIATFESSLEDVGVELVRTTADEFESSLAPLLDSPAVG
6381|hp|nrc1       MVGPGRKHPLTVGTIFWDMSAEPIATFESSLDEVGVELVRTTADEFASTLSPLLDAPTVG
15180|hp|hbo       ------------------MSTGTVATFEASLDRLDVDWTHASAAEFETVLRDVCSDPTIG
                                             *  ::         :    .   :      *::*

361|hp|hut         IPI-------PIDGASLPS-AVDTDPDPAAVRAAATGVTPATLGIADYGSVLLPSDDHGS
1724|hp|nph        TPL-------SFEGVSFGEVAIEMDPSPAALTAAETGVTPAGLGIADYGTVTIDGRAAGD
5150|hp|hhi        IALDKTAGDEAFSLTGTP---VTVDPTPVALREATTGVTGAELGIGDYGSLVLSMTEEAS
7018|hp|hma        VALDETVGDGTFSLVETP---ITVDPTPAALREATTGVTGAELGVGDYGSLVLSMTEQAS
2668|gene|hla      APL-------PFENLSLPD-TVETEPSVADLEAASTGVTAAGYGIADYGSVVIQGGANGE
6381|hp|nrc1       TSL-------PFETVSLPD-SVETDPSIADLEAAATGVTAAGYGIADYGSVIIQGGTDGE
15180|hp|hbo       VPL-------THD-VTLPD-WVNTDPTPDDLRTAATGVTEAGLGIADYGSVVLQGTPDGI
                    .:       . .        :  :*    :  * **** *  *:.***:: :     . 

361|hp|hut         GLLSLFPETHIPVVSERDVVGTMADAFGELGPQL-RDDRGDVIIATGPSATSDMGEIVRG
1724|hp|nph        ELVSLYPPRHVVVVDESDIVPDMAAAFERFEQTIGGDGPDSCVLATGPSATADMGTLVEG
5150|hp|hhi        ELLSLFVERHVAILHEEDIQPDMDAAVAELDERF-NETGGSAIIATGPSATADMGALVKG
7018|hp|hma        ELVSLFVERHVAILYEEDIQPDMDAAVAELDERF-TETNGSAIIATGPSATADMGALVKG
2668|gene|hla      EPVSLYVDEHVAVVAASDILPDMDATFDRLAEDI-RGGTGQAIIATGPSATADMGGLVKG
6381|hp|nrc1       EPVSLYADEHVAVVAASDVLPDMDATFDQLAEDI-RNGVGQSIIATGPSATADMGALVTG
15180|hp|hbo       EPVSLFSDRHVAVLRKSDIAPGMGAAFEWLGETF-RTGHSSAIIATGPSATADMGALVKG
                     :**:   *: ::   *:   *  :.  :   :     .. ::*******:*** :* *

361|hp|hut         VHGPTDVHVVIVEQ--
1724|hp|nph        VHGPTEVHVVVVER--
5150|hp|hhi        AHGPKEVHVIIVEEGA
7018|hp|hma        AHGPKEVHVIIVEEED
2668|gene|hla      AHGPIDVTVVLLEDR-
6381|hp|nrc1       AHGPMDVTVVLLEGK-
15180|hp|hbo       AHGPKAVHVVILDE--
                   .***  * *::::