HOG Organism Gene ID Name Annotation
aHOG1220 hbo HBOR23380 Hbor_23380 hypothetical protein
aHOG1220 hla HLAC0904 Hlac_904 hypothetical protein
aHOG1220 hut HUTA0653 Huta_0653 conserved hypothetical protein
aHOG1220 nph NP0526 hypothetical protein
aHOG1220 nrc1 VNG1664 vng1664 no entry
aHOG1220 hma Hma_13331 hypothetical protein
aHOG1220 hma Hma_6066 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


653|chp|hut       MDRELSLPVAVGIILAVIAAGTGGLIVAPIGMTAETTLMMVLPSMLVFAVVVFVVGVMHG
1664|hp|nrc1      --MRFDFTRAVGLLAAFVAVGMIGLSAADV-MPARVMFMMVLPSMIVFAAISFLIGMKHG
13331|hp|hma      --MDFDFVPAVAPLVVIVAIATVGLT--SV-MTLSTVLMMVLPSMIVFSVVAFFLGMKHG
6066|hp|hma       --MEFDFVRSVAPLVVIVAVAAIALT--TV-MTSSTVFMMVLPSMIIFSVIAFFLGMKHG
23380|hp|hbo      --MEFNLPVTAGALVGLVALGTVGLIMMPA-MQTRTVLMMVAPSMLVFGAICLVLGIKHG
904|hp|hla        --MEFDLPRAAGIVALIVALGTAGVAFGTP-MALSTTLMMVLPSMVVFGAIAFVTGMKHG
526|hp|nph        --MQFNLPVALGALLVIVAIGAGGLVASGM-MILETTLMMVVPSMVVFGLIAFGLGVKHG
                      :.:  : . :  .:* .  .:      *   . :*** ***::*. : :  *: **

653|chp|hut       QHRANT--
1664|hp|nrc1      EHRITG--
13331|hp|hma      EFRASP--
6066|hp|hma       EFRASA--
23380|hp|hbo      EYRASSTR
904|hp|hla        EFRATHA-
526|hp|nph        EYRAA---
                  :.*