HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0121COG2928arCOG04755Uncharacterized conserved proteinhypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0121 nrc1 VNG2121 vng2121 no entry
cHOG0121 hmu HMUK1108 Hmuk_1108 protein of unknown function DUF502
cHOG0121 hma RRNAC3070 hypothetical protein
cHOG0121 hwa HQ3231A hypothetical protein
cHOG0121 hla HLAC0352 Hlac_352 protein of unknown function DUF502
cHOG0121 hbo HBOR28410 Hbor_28410 uncharacterized conserved protein
cHOG0121 hut HUTA2020 Huta_2020 protein of unknown function DUF502
cHOG0121 hvo HVO_0330 HVO_0330 Protein of unknown function (DUF502) family
cHOG0121 nph NP0986A hypothetical protein
cHOG0121 hhi 325 HAH_0325 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


986|hp|nph         -MLSSSWKRDIASGLIVLVPLLVTAYVVAFIYQAIANLPLFEEALG------GLPVAV--
2020|hp|hut        --MASTWKRDFASGLIVITPLLVTVMVLLWLYNRLEGIPL-----------PVEPAPL--
13070|hp|hma       MASSTSWKRDFASGLIILLPLLVTIYVILYLYSILASAAVIPAIDGELLAALGLPSGTSS
325|hp|hhi         MASSTSWKRDFASGLIILLPLLVTVYVIIYLYSILASAAVIPAIDGELLAALGLPSGTSS
352|gene|hla       ---MSTWKRDFASGLIVLAPLLVLLLVLQWIYQYIASIPLIEGLQPAIIPAPLEPIS---
2121|chp|nrc1      ---MGSWKRDFASGLIVLVPIVVTLYVIYWLFGLLSNITLFTQL--------TDTQYQ--
3231|hp|hwa        ---MSSWRRDFASGLVVVVPLLVILSVVNYLYSRIVSLPFVRRL--------QEPFGF--
28410|hp|hbo       ---MSSWRRDFASGLVVLVPILVILYVLSILYNSIIELPIIKGL--------HQPFGF--
                        :*.**:****::: *::*   *:  ::  :   ..              .     

986|hp|nph         ----RVVVTLVLFVLLVLSVGYLMRTTAGDLLEEALDNVMNRLPGLRVVYNASKMAVETA
2020|hp|hut        ----RVGLTIVVFILLVFAVGYLMRTAVGSIVEDAIDDLMNQLPGLRVVYNASKMAAETA
13070|hp|hma       VELARVFTTLIIFILIVFSIGYLMRTAFGDIVERAIDDAMNHVPGLRVVYNASKMAVETA
325|hp|hhi         VELARVFTTLIIFILIVFSIGYLMRTAFGDIVERAIDDAMNHVPGLRVVYNASKMAVETA
352|gene|hla       ----RVIIAMAVFATVVLAVGYFMRTTFGRLAESAVDGAINRIPALRVVYNASKLAIETA
2121|chp|nrc1      ----AVAATLAVFVLIVFSVGYLMRTAAGSILEALIDYVMNRLPVLRIVYNASKMAVETV
3231|hp|hwa        ------FAAIIVFVLLIFSVGYLMRTTAGRLIENYLDAAMNRVPLIRVLYNASKLAVETA
28410|hp|hbo       ------FVAIIVFMMLVLSVGYLMRTTAGRLFESGIDAAMNRLPLVRVLYNASKLAVETA
                           :: :*  :::::**:***: * : *  :*  :*.:* :*::*****:* **.

986|hp|nph         VS-GTDDLQTPVKLETWNGMRMTAFKTGQQTEDGRDMLFLPTAPNITTGFVIEVEPDRYT
2020|hp|hut        LS-GTDELQAPVKLETWDGMRMTAFLTGKTTEDGRDVLFLPTAPNITTGFVVEVEPDRYT
13070|hp|hma       VG-GTEDLQAPVKLEVWDGMRMTAFKTGQTTDDGREVLFLPTAPNITTGYVVEVEPHRYE
325|hp|hhi         VG-GTEELQAPVKLEVWDGMRMTAFKTGQTTEDGREVLFLPTAPNITTGYVVEVEPHRYE
352|gene|hla       VS-GTDELQSPVYIETWPGIRMTAFRTGKKTRDGKIVLFMPTAPNITTGFVIEVEPERIE
2121|chp|nrc1      LSDGTGEFQQPVRVEPWPGMRLTAFKTGKKAPDGREVVFMPTAPNITTGFVMEVEPEDLE
3231|hp|hwa        LS-GTEELQTPVKVETWPGMRMTAFKTGKTTVDGREVLFMPTAPNITTGFIIEVETSDIT
28410|hp|hbo       LT-GTEDLQKPVRLEVWPGIRMTGFKTGKTTQDGREVIFMPTAPNITTGFVMEVEPEDLT
                   :  ** ::* ** :* * *:*:*.* **: : **. ::*:*********:::***.    

986|hp|nph         ELDESVEEALTRVLSAGFGERNTQS--------------------IQIDVTEGPPTAKTE
2020|hp|hut        EIDERVEDALTRILSAGFGESDEKS--------------------IQVDVEDVVSEVGGS
13070|hp|hma       EIDERVEEALTRILSAGFGDTDRSN---------------------------ATPIPVAD
325|hp|hhi         EIDERVEEALTRILSAGFGDTDRST---------------------------ATPIPVAD
352|gene|hla       ETGETVEEGMTRVLSAGFAESAHQVPVEEERPPEGTTGQPGGVGGVRTDGTPGESDRPST
2121|chp|nrc1      ETDEGVEDALTRVLSAGFGENDDSE--------------------VAID-----ELLPED
3231|hp|hwa        ETDETVEEALTRTLSAGFADEDRNA---------------------STESATGASFSTTE
28410|hp|hbo       ETDERVEEALTRILSAGFAEDESVS---------------------------------AI
                   * .* **:.:** *****.:                                        

986|hp|nph         KRPSSDSE
2020|hp|hut        PDGERDAD
13070|hp|hma       EDDLADD-
325|hp|hhi         EEDLADD-
352|gene|hla       DGGGEGD-
2121|chp|nrc1      DDDENEE-
3231|hp|hwa        NIDSSDN-
28410|hp|hbo       DIDVEEE-