HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0120arCOG04739hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0120 nrc1 VNG2490 vng2490 no entry
cHOG0120 hmu HMUK1069 Hmuk_1069 conserved hypothetical protein
cHOG0120 hma RRNAC2895 hypothetical protein
cHOG0120 hwa HQ2005A hypothetical protein
cHOG0120 hwa HQ3438A hypothetical protein
cHOG0120 hla HLAC0009 Hlac_9 hypothetical protein
cHOG0120 hbo HBOR01270 Hbor_01270 hypothetical protein
cHOG0120 hut HUTA0461 Huta_0461 conserved hypothetical protein
cHOG0120 hvo HVO_0095 HVO_0095 membrane protein putative
cHOG0120 nph NP0702A hypothetical protein
cHOG0120 hhi 161 HAH_0161 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


2005|hp|hwa       --------MTTANQKE---------FGETWVYESIISALPGIDIPNTLAIGIQLVFFETA
2490|hp|nrc1      MSDSRDPPPSDYQEPTSTAHAAGGVYGETWVYESIVGAIPGIDISDRLAVLIQFVLFEVG
461|chp|hut       -MTPRQPDGRDVSDPR---------SNQRWVYESIVGSIPGVSLSRGAALVLQLVIFEAG
3438|hp|hwa       -MARSSAHAGTESSP----------YGDTWVYESIIGALPGIELSDTEAIALQLGLFEVA
1270|hp|hbo       -----------MTRTQ---------FGETWVYESIVGALPGIHLTDGEAIALQLGLFEVF
9|hp|hla          ------------MSRN---------YGEMWVYESLVGGIPGLDISRRLAVAIQFVLFEVG
12895|hp|hma      -------MSGDSARPD---------YGETWVYESIIGALPGIRLPTWAAMAIQLLIFEVA
161|hp|hhi        -------MSGDSARPE---------YGETWVYESIIGALPGIRLPTWAAMAIQLLIFEVA
702|hp|nph        -------------MPE---------YGETWTYESIVGAVPGIDVPPRAAIAIQIAVFEGA
                                            .: *.***::..:**: :.   *: :*: .**  

2005|hp|hwa       VLAFAVWDNNGAIAIVGSAAVLLATLGSVEMLRISRLVRSRAVPTSYKRLLFGSKVETVL
2490|hp|nrc1      VLVTAAVYDLPGAILPGTAAVLVAAAGSAFMLDIGARARGPGVPARYRQLLFASSIEVVL
461|chp|hut       VVALAAGYGRWGSLPAGTVAVVVASAGSVFMLTIGRRTRRLDVPEQYTHTLFGTGIEIVL
3438|hp|hwa       VIVLSIGYGIESAILPGTVAVFEAAVGSGAMQRLGRGTRELDLPQSYRQFLFGSSIEVVL
1270|hp|hbo       VVFFAWAYDLWEAVLPGSIAVGVAAVGSVVMLRMGQTTRETNLPDAYTRLLFGSSIEVVL
9|hp|hla          VVALGWYYGLWDAVVAGTVAVAVAAVGSVEMHRLGAINRRLPTPPAHKRLLFGSSIEIVL
12895|hp|hma      IIALSWYYEVWSAAIAGTVVVFVATIGSAEMLRISTLIRRIDVPPTYRALLFASNVEVVL
161|hp|hhi        IVALSWYYEVWSAAIAGTVVVFVATIGSAEMLRISTLIRRIDVPPTYRALLFASNVEVVL
702|hp|nph        VLLLAWYYGLWSAAVAGTVAVAVAALGSAEMLRIGAAVRRTDPPAAYRRLLFGTSIEVVL
                  ::  .           *: .*  *: **  *  :.   *    *  :   **.: :* **

2005|hp|hwa       GVLVYVALITHLFVFEPQQSVRPLLHSLLGANPPIVVMYVLLLVGWDISYRIGTNWWASL
2490|hp|nrc1      GVVSYVLLMTYLFVWDPR-DGATLVAGLLGEQPPVIPSALALLVLWDVCYRIGTGWWAAV
461|chp|hut       GLVAFFALVTYLFVLDPGSGGETVLTGLLGEPLPAPAVFFTLVVLWDVCYRIGTGWWASL
3438|hp|hwa       GVLAFVALVTHLFVFDPRGTGMTIIESFLGENPPILVVYLTLLILWDLCYRIGTSWWAAV
1270|hp|hbo       GVLAFVALVTHLFVYDPRQSGTTLFVSLFGREPPVIVVYLTLLVLWDLCYRIGTSWWAAI
9|hp|hla          GVLAFIALVTYLIAWD-----GALLDRLFGPDPPIPVVYLSLLILWDLTYRIGTSWWSAV
12895|hp|hma      SVLAYIALLTHLFVFDPQVSSMPLLGRLFGPEPPVLVVYLTLLILWDVSYRIGTGWWASV
161|hp|hhi        SVLAYVALLTHLFVFDPQVSSTPLLGQLFGSEPPVLVVYLTLLILWDVSYRIGTGWWASV
702|hp|nph        SVLAFVALVTYLVRLSPGSS----LATVFGPEAPLPVVYLTLLVLWDLCYRIGTGWWASL
                  .:: :. *:*:*.  .        .  .:*   *     . *:: **: *****.**:::

2005|hp|hwa       LGLWRAGRYRISNEGSHEFNLDPETARLLRRADSETALFGLLQLSIAPVLKTGSVLQNVL
2490|hp|nrc1      VALWRSLTQS----------LQPATASRMAGVDKRTLGFGTAQAVLLPFVWGHPLLVFAV
461|chp|hut       IGLWRSLWLSEA--------LDRETVDELRRIDAITIGFAWIQLSLVPFVVGHPILVAAV
3438|hp|hwa       VALWRSWRYE----------FDSETAGKLRRLDALNAGFGLTQVAMVPFVIDRPVLLTAV
1270|hp|hbo       VSLWGSLRFT----------VDSTTAQTLRVADAWNVIFGIAQLALVPFILNQRMLLLAV
9|hp|hla          VALWRAVHVD----------LSPAATSRARRLDAENIAFSALQLVLVPFLLSEPVLLGAV
12895|hp|hma      TGLWRSARYR----------FDPETARVFMRADLEIWGFGVLQLVLVPFVLDQPVLLAAL
161|hp|hhi        TGLWRSARYR----------FDPETARVFIRADLEIWGFGVLQLVLVPFVLDQPVLLAAL
702|hp|nph        VGLWRSARYR----------FSPAAAGQFRRIDAETILFGFAQLLLVPFVTEYPLLVAAL
                   .** :              ..  :.      *     *.  *  : *.:    :*  .:

2005|hp|hwa       IIHVIAVVIVSGTAAILMSPSFY-------
2490|hp|nrc1      AGHVVAVIVVTTVSLSVLRN----------
461|chp|hut       VGHVVAITLVSGASILVLHRMR--------
3438|hp|hwa       GGHVIAVIGVSLAALVTLDEIDVSTT----
1270|hp|hbo       AGHVVAVTVVSTVAAVTMRIE---------
9|hp|hla          VGHVLAVAIVCSAAIVLS------------
12895|hp|hma      VGHVIAVTAVTAVSVGLLRYRSRTTAVSRS
161|hp|hhi        VGHVIAVTAVTAASVGLLRYRSRTAAVSQS
702|hp|nph        VGHVLAVTVVSGSSILLLWRREHVTASA--
                    **:*:  *   :