HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0012COG0714arCOG00434MoxR-like ATPasesmoxR-like ATPase

HOG Organism Gene ID Name Annotation
cHOG0012 nrc1 VNG0223 moxR moxR-like ATPase
cHOG0012 hmu HMUK0032 Hmuk_0032 ATPase associated with various cellular activities AAA_3( EC:3.6.3.- )
cHOG0012 hmu HMUK2110 Hmuk_2110 ATPase associated with various cellular activities AAA_3( EC:3.6.3.- )
cHOG0012 hmu HMUK1090 Hmuk_1090 ATPase associated with various cellular activities AAA_3( EC:3.6.3.- )
cHOG0012 hma RRNAC0952 moxR1 methanol dehydrogenase regulatory protein
cHOG0012 hma RRNAC1698 moxR2 methanol dehydrogenase regulatory protein
cHOG0012 hma RRNAC3062 moxR5 methanol dehydrogenase regulatory protein
cHOG0012 hwa HQ2259A moxR MoxR-like ATPase
cHOG0012 hla HLAC0402 Hlac_402 ATPase associated with various cellular activities AAA_3
cHOG0012 hla HLAC0585 Hlac_585 ATPase associated with various cellular activities AAA_3
cHOG0012 hbo HBOR25720 Hbor_25720 MoxR-like ATPase( EC:3.6.3.- )
cHOG0012 hbo HBOR37000b Hbor_37000 MoxR-like ATPase( EC:3.6.3.- )
cHOG0012 hut HUTA2421 Huta_2421 ATPase associated with various cellular activities AAA_3
cHOG0012 hut HUTA1176 Huta_1176 ATPase associated with various cellular activities AAA_3
cHOG0012 hut HUTA1882 Huta_1882 ATPase associated with various cellular activities AAA_3
cHOG0012 hut HUTA1942 Huta_1942 ATPase associated with various cellular activities AAA_3
cHOG0012 hvo HVO_0639 HVO_0639 moxR methanol dehydrogenase regulatory protein
cHOG0012 nph NP4650A MoxR-like ATPase
cHOG0012 hhi 2232 moxR5 methanol dehydrogenase regulatory protein
cHOG0012 hhi 1581 moxR2 methanol dehydrogenase regulatory protein
cHOG0012 hhi 318 moxR1 methanol dehydrogenase regulatory protein
MUSCLE (3.6) multiple sequence alignment


2259|gene|hwa       ---------------------MTIDKFSIEEAGSHIERIIDEISSAVITDRSFLEVIITG
1882|gene|hut       --------------------------MDIDAAATQCREVIDLLNEAVVADRTFFEDLLVG
10952|gene|hma      -------------------MAGLSSDLSVASASEHCLNIVERVEEAVVVERRVLFETLAG
1581|gene|hhi       ---------------------------------------MERVEEAVVVERRVLFETLAG
402|gene|hla        --------------------------MDPATVQQRSDQILDGIASVVVSERSTLKTVLVG
4650|gene|nph       ---------------------MGVEGPSFAETSNTCKKIIERVSDAVITDREFLKTVLTA
1942|gene|hut       --------------------------MAVPDTAETVQAVIDEIRSAVIADPTVLEEITAG
37000|gene|hbo      --------------------------MDVPQAAATCDDVVEAVSAAVVAERDFLETVLTG
13062|gene|hma      MGVMESGRPPAKPRERVFVGGCLHAGMDHDTAGRTSRQILDAVGSAVIADDHFLETVMTG
318|gene|hhi        --------------------------MDHDTAGRTSRQILDAVGSAVIADDHFLETVMTG
1176|gene|hut       -----------------------MPSLDISDASARCTDVLDAMEGTVIADRTFLETVLTG
223|gene|nrc1       --------------------------MDASSVRDGCSAVVDEVAAAVIADREFLETVLVG
2421|gene|hut       --------------------------MDVAEASDTCTTLLDELESAIITNQEFLETVLLG
11698|gene|hma      --------------------------MDATEASEVSSQILDEIGSAVIADRGFFETVLLG
2232|gene|hhi       --------------------------MDATEASEVSSQILDEIGSAVIADRGFFETVLLG
585|gene|hla        --------------------------MDVPEAAAACSRVVDEVGGAVVADREFLDRVTLG
25720|gene|hbo      --------------------------MDIPEASEACSSVLAEVSKAVIAEQEFLERIMLG
                                                           :  :  .:: :   :     .

2259|gene|hwa       LLARGHVLVEDVPGTGKTLTAIALADAFGLEYNRIQFTPDLLPSDITGTHIFDEQTGEFS
1882|gene|hut       LLAGGHVLIEDVPGTGKTLTARSTATVLGLSFSRVQLTPDLLPADVMGSQVFNQRDREFE
10952|gene|hma      VIARGHVLVEDVPGTGKTALARVLAEALGLEFTRIQFTPDLLPADVTGSNVYNEHEREFE
1581|gene|hhi       VIARGHVLVEDVPGTGKTVLARVLAESLGLEFNRVQFTPDLLPADVTGSNVYNEHEREFE
402|gene|hla        LLSDGHILLEDVPGTGKTLTARSFANAVDVSFSRVQFTPDLLPSDVIGSNVFDEKTQSFE
4650|gene|nph       TLARGHVLLEDVPGTGKTLTALTFAQALGLEFSRIQFTPDLLPNDITGSHVFNEQTGDFE
1942|gene|hut       ILARGHILLEDVPGTGKTLTARSFATALGLEFSRIQFTPDLMPSDITGSYIFQEGTEEFH
37000|gene|hbo      VLARGHVLLEDVPGTGKTLTARSIAAALGLSFARIQFTPDLLPADITGSNVYDERQGAFE
13062|gene|hma      ILARGHVLLEDVPGTGKTLTAQSFATALDLSFKRVQFTPDLLPSDITGSNVFNEATGEFD
318|gene|hhi        VLARGHVLLEDVPGTGKTLTAQSFATALDLSFKRVQFTPDLLPSDITGSNVFNEATGEFD
1176|gene|hut       VLARGHVLLEDVPGTGKTLTARSMAEALGLSFNRIQFTPDLLPADVTGSHIYNERERDFE
223|gene|nrc1       FLADGHVLLEDVPGTGKTLTARSVATALGLEFSRVQFTPDLLPTDVLGTHVFNERSREFE
2421|gene|hut       VLGRGHVLLEDVPGTGKTLTARSLAKALGLSFSRVQFTPDLLPTDVTGTHIYNERDRSFE
11698|gene|hma      VVAKGHVLLEDVPGTGKTLTARSVATALGLSFSRIQFTPDLLPADITGTHIFNEESRSLE
2232|gene|hhi       VVAKGHVLLEDVPGTGKTLTARSVATALGLSFSRIQFTPDLLPADITGTHIFNEESRSFE
585|gene|hla        ILARGHVLLEDVPGTGKTLSARSFAAALGLEFSRVQFTPDLLPSDVTGTNVFDEGDGSFA
25720|gene|hbo      VLSRGHVLLEDVPGTGKTLSARSVATALGLSFSRVQFTPDLLPSDVTGTNIFNEREQSFE
                     :. **:*:*********  *   *  ..:.: *:*:****:* *: *: ::::    : 

2259|gene|hwa       FQQGPLFANVVLADEINRAPPKTQSALLEAMDEQQVTVGGDTYPLPEPFFVIATQNPVEQ
1882|gene|hut       FRQGPLFANVVLADELNRAPPKTQSALLEAMEEGQVTIEGDTHPLPAPFFVIATQNPIEE
10952|gene|hma      FAQGPVFSNVVLADEINRAPPKTQSALLESMEERQVSVDGTTHPLPTPFVVIATQNPIEQ
1581|gene|hhi       FAQGPVFSNVVLADEINRAPPKTQSALLESMEERQVSVDGTTHPLPTPFVVIATQNPVEQ
402|gene|hla        FQPGPVFANVVLADEINRAPPKTQAALLEAMEEGQVTVDGETHPLPDPFVVIATQNPVEM
4650|gene|nph       FTKGPVFANVVLADEINRAPPKTQAALLEAMDESQVTVDGTTRRLPDPFLVIATQNPVEQ
1942|gene|hut       FTPGPVFGNVVLADEINRAPPKTQSALLEAMAEGQVTVDGETHALPEPFVVIATQNPVEQ
37000|gene|hbo      FQPGPIFANVVLADEINRAPPKTQAALLEAMGEGQVTVDGVTHDLPNPFFVIATQNPVEQ
13062|gene|hma      FQPGPVFANVVLADEINRAPPKTQAALLEAMGEKQVTVDGVTHDLPEPFFVIATQNPVEQ
318|gene|hhi        FQPGPVFANVVLADEINRAPPKTQAALLEAMGEKQVTVDGVTHDLPEPFFVIATQNPVEQ
1176|gene|hut       FREGPIFANVVLADEINRAPPKTQAALLEAMSEGQVTTDGTTRDLPEPFFVIATQNPVES
223|gene|nrc1       FRPGPVFANVVLADEINRAPPKTQAALLEAMEEGQVTIDGETMALPEPFFVIATQNPVDQ
2421|gene|hut       FSEGPIFANIVLADEINRAPPKTQSALLEAMEEGQVTAGGDTYQLPKPFFVIATQNPVEM
11698|gene|hma      FTEGPVFANVLLADEINRAPPKTQSALLEAMEEGQVTVDGDTYELPEPFFVIATQNPVDM
2232|gene|hhi       FTEGPVFANVLLADEINRAPPKTQSALLEAMEEGQVTVDGDTYDLPEPFFVIATQNPVDM
585|gene|hla        FSPGPIFANVVLADEINRAPPKTQAALLEAMEEGQVTVDGETHDLPDPFYVIATQNPVES
25720|gene|hbo      FSEGPIFANVVLADEINRAPPKTQAALLEAMEEGQVTVDGETHELPKPFFVIATQNPVES
                    *  **:*.*::****:********:****:* * **:  * *  ** ** *******:: 

2259|gene|hwa       EGTFSLPEAQQDRFILKTSIGYPSREGELELINRRSNRQLTTPEVDAVINPDQVVTLRQT
1882|gene|hut       SGTFELPEAQKDRFLIKTQLGYPDRSGERTILDRRLARDAATPSVEKLLESGTVQSLRDV
10952|gene|hma      EGTFQLPEAQRDRFSVKTSMAYPDVEGEMGLLDRRANRRTLSPSVDPVVDPETVRALQEC
1581|gene|hhi       EGTFQLPEAQRDRFSVKTSMEYPDVEGEMGLLDRRANRRTIAPSVEPVMGPETVRALQEC
402|gene|hla        EGTFELPAAQKDRFIVKTSLGYPDRAGELELIDRRAGRQASSPSVRTVCSLDTLTQLRRA
4650|gene|nph       EGTFELPEAQRDRFIVKSSIGYPDKEGELELLERRSQRHAKMPTVDSVLDTEGAQRIQMV
1942|gene|hut       EGTFELPEAQRDRFMIKTSLGYPDADGTRELIDRRADRDHPDPTVERVADRTDVLDFQQE
37000|gene|hbo      EGTFRLPEAQRDRFIVKTELGYPGREGERELIDRRADRTRRSPSASRVVTDEQVSALRSV
13062|gene|hma      EGTFGLPEAQRDRFIVKTSMGYPDFGGERELIDRRADRTAQAPSVTSVIDGERLPALQRT
318|gene|hhi        EGTFGLPEAQRDRFIVKTSMGYPDFGGERELIDRRADRTAQAPSVTSVIDGERLPALQRT
1176|gene|hut       EGTFPLPEAQIDRFIVKTSIGYPDPDAEQTLLRRRTDRASKTPSVEAVLEPDRVTAIQTL
223|gene|nrc1       EGTFPLPEAQLDRFVVSAAIGYPDAAGERELLARRASRDARSPTVDAVLDDERVRALRRA
2421|gene|hut       EGTFELPEAQVDRFAIKAAMGYPDLDGEVELLRRRAGRDEQSPSVETVLDAESVTALRQV
11698|gene|hma      EGTFELPEAQVDRFLAKTSLGYPDGEGEVELLRRRAGRTTQSPTVEPVLDAESVKELRSV
2232|gene|hhi       EGTFELPEAQVDRFLAKTSLGYPDDEGEVELLRRRAGRTTQSPTVEPILDAESVTELRSV
585|gene|hla        EGAFPLPEAQLDRFTIKTAIGYPGDEGEVELLRRRAGRVEQAPTVERVLDPDAVAGLREV
25720|gene|hbo      EGTFPLPEAQIDRFVVKTSIGYPDSDGEVELLRRRVGREARSPSVGSVLSREEVMDVRLV
                    .*:* ** ** ***  .: : **.  .   :: **  *    * .  :        ..  

2259|gene|hwa       PEYVSMRLNVREYLTDIARQTRKDDRVEVGVSPRGIQRFYEAARAYAVIAGRSYVTPDDV
1882|gene|hut       PETVSVEGDLREFMLDLTRETRSHHHIRTGVSPRGTQRLLEASRAFAVIEGRDYVVPDDV
10952|gene|hma      AEDIRVDTKVRRYIVDLARATREDDRTEIGVSPRGVQRVFEAVRASAVIAGRRYSTPDDV
1581|gene|hhi       AEDVRVDTKVRRYIVDLARATREDDRTEIGVSPRGVQRVFEAVRASAVIAGRRYSTPDDV
402|gene|hla        PESIRVEDGVRQYLVDVARATRTDERVNTGVSPRGIQRFFEVVRTHAALMGRSYATPDDV
4650|gene|nph       PERITMDSAIREYLVTLARETRTDRRVDVGISPRGIQRYFEAARAKAAIEGRDYVAPDDV
1942|gene|hut       PETITVEDPVRDYIADLCRATRTDGRVEVGVSPRGVQRLFEAARARAVIDGREFVVPDDV
37000|gene|hbo      PEHVRVDEKLRDYIVDLGRATREDARVDVGVSPRGIQRLFEAARARAVIRGRDYAVPDDV
13062|gene|hma      VESVTVDGTLRDYVVELGRATREDDRVDVGVSPRGIQRLFEATRAAAVLDGRDYAVPDDV
318|gene|hhi        VESVTVDGTLRDYVVELGRATREDDRVDVGVSPRGIQRLFEATRAAAVLDGRDYAVPDDV
1176|gene|hut       PEDVTVTDDLIAYMTDIVGATRDQPQIRVGVSPRGTQRLLEAARARAVIEGREYVTPGDV
223|gene|nrc1       SEDVRVGSDLREYMVAVARATREHPRVEVGVSPRGTQRLFEAARARAVVAGREYVVPADV
2421|gene|hut       PETIRVEDDLLEYMAAVTRATREHRHVEVGVSPRGTQRLFEIARARATISGREYVTPDDV
11698|gene|hma      PETVTVDDDLLQYMADLVRATRDDYRVDVGVSPRGTQRLFEATRAMATIAGREYVAPDDI
2232|gene|hhi       PETVTVDDDLLQYMAALARATRDDYRVDVGVSPRGTQRLFEAARAMATIAGREYVAPDDI
585|gene|hla        PERVRVDDDLLKYMASIARATREDRRVDVGVSPRGTQRLFETARAAAVVAGREFVTPDDV
25720|gene|hbo      PEDVRVDEDLLHYMADIARTTRNDRRVDVGVSPRGTQRLLEASRARAVLSGREFVTPDDV
                     * : :   :  ::  :   **   .   *:**** **  *  *: *.: ** : .* *:

2259|gene|hwa       KTIASAVITHRLVLTSEATIRDIKPKAVTHSVLDAVDVPAAQGMK---------------
1882|gene|hut       TRMAEPVLAHRLVLTPEATVQEIEKRELVREIVEDTPVPTVQADATA-------------
10952|gene|hma      KRLANATMSHRLVLTTEATIEGTEKADVIQAALDAVDVPAVSPNAP--DDTPEPTTTGGS
1581|gene|hhi       KRLANATMSHRLVLTTEATIEGTEKADVIQAALDAVDVPAVSPNAPDTDDTPKQTTTGGS
402|gene|hla        KAMAPPALSHRIVVTPDARVSGVSTTEIVDDILSEIPMPQLRA-----------------
4650|gene|nph       KQIAEPVMQHRIVLTTDAQIDGISGADVVYDVLERVETPTPQK-----------------
1942|gene|hut       RRIAPPVLAHRLVLTPEASVEGVSRRSIVESVLDRVSVPAMEEPPAEQ------------
37000|gene|hbo      KAAAPSVFRHRLVLTSDARVRGVDPLDVVDEVLDSVPVPPVASARQND------------
13062|gene|hma      KTVVEEAFAHRLVLTADAGVRGVDPATVVDDVLDRVEVPAVSP-----------------
318|gene|hhi        KSVVGEAFAHRLVLTADAGVRGVDPATVVDDVLDRVEVPAVNPGR---------------
1176|gene|hut       KTIAPDVLAHRLVLTPDATVENVDKRDVLVDVLDSIPVPTVSDVDAPAPG----------
223|gene|nrc1       KGLAGSVLAHRLVLTPDAAVENVAKGGIVEGVLDEVPVPTVDAA----------------
2421|gene|hut       KRVARPALAHRLVLTPDARVDEVPKPSVIDRILDDIPVPTI-------------------
11698|gene|hma      KRVAQPVLAHRLVLTPDARVEQVDKGTVIQSVLDEVPVPTV-------------------
2232|gene|hhi       KRVAQPVLAHRLVLTPDARVEQVDKGTVIQSVLDEVPVPTV-------------------
585|gene|hla        KRVAEPALAHRLVLTPDAAVNDTDKQDVIADVLDRIAVPTVDAAEA--------------
25720|gene|hbo      KRVSPAVLAHRLVLTPDAQVNDVAKADVVSDVLERVEVPTIE------------------
                          .: **:*:*.:* :       :    :.    *                     

2259|gene|hwa       ------------------------------------------------------------
1882|gene|hut       ------------------------------------------------------------
10952|gene|hma      ERADSPSEATPDGDSSGQRPERSAGEAAENEATQLDGDDGQPTDSAGDTPSRSGEDDIGH
1581|gene|hhi       ERADSPSEATPDGDSRGQRPERSAGEAAENEATQLDGDDGQPTDSSGDSRDRS-DDDSGH
402|gene|hla        ------------------------------------------------------------
4650|gene|nph       ------------------------------------------------------------
1942|gene|hut       ------------------------------------------------------------
37000|gene|hbo      ------------------------------------------------------------
13062|gene|hma      ------------------------------------------------------------
318|gene|hhi        ------------------------------------------------------------
1176|gene|hut       ------------------------------------------------------------
223|gene|nrc1       ------------------------------------------------------------
2421|gene|hut       ------------------------------------------------------------
11698|gene|hma      ------------------------------------------------------------
2232|gene|hhi       ------------------------------------------------------------
585|gene|hla        ------------------------------------------------------------
25720|gene|hbo      ------------------------------------------------------------
                                                                                

2259|gene|hwa       --
1882|gene|hut       --
10952|gene|hma      GQ
1581|gene|hhi       GQ
402|gene|hla        --
4650|gene|nph       --
1942|gene|hut       --
37000|gene|hbo      --
13062|gene|hma      --
318|gene|hhi        --
1176|gene|hut       --
223|gene|nrc1       --
2421|gene|hut       --
11698|gene|hma      --
2232|gene|hhi       --
585|gene|hla        --
25720|gene|hbo      --