HOG COG KOG arCOG COG description NRC-1 annotation
nucHOG0119arCOG03922hypothetical protein

HOG Organism Gene ID Name Annotation
nucHOG0119 nrc1 VNG1362 vng1362 no entry
nucHOG0119 hmu HMUK2784 Hmuk_2784 conserved hypothetical protein
nucHOG0119 hma RRNAC0035 hypothetical protein
nucHOG0119 hwa HQ2415A hypothetical protein
nucHOG0119 hla HLAC2033 Hlac_2033 hypothetical protein
nucHOG0119 hbo HBOR13880 Hbor_13880 hypothetical protein
nucHOG0119 hut HUTA2509 Huta_2509 conserved hypothetical protein
nucHOG0119 hvo HVO_2876 HVO_2876 conserved hypothetical protein
nucHOG0119 nph NP3794A hypothetical protein
nucHOG0119 nph NP4290A hypothetical protein
nucHOG0119 hhi 795 HAH_0795 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


3794|hp|nph       --MSEQSFLEQRLD---ASTWPIAVGDIVVLLAFIFLGTLSHWPLDAMLADPTIYLAAAG
2033|hp|hla       --MADSSFLATRLD---RDAVPLAIGDLIALIVLLTIGALNHSTVEFLSANPLYLLEVYA
2415|hp|hwa       MAHSEESFLTRRID---AGAYPLAVGDILGISAVLTIGVIFHNGIEYLSTAPIGWGLTIL
13880|hp|hbo      MGTSNGSFLDQRLD---ADALPLAVGDFLMLAAVLTIGFINHNGVDQIFDDPTGWILTLV
1362|hp|nrc1      --MTLTDV-DGRAV---ARFLP---GDVVVILVVILAGTLRH-GT---FT-PQEYAGVLL
4290|hp|nph       ---MLSTRYADRWTVSVRRTALVAVGDIVAIAAFLLYGLLIH-AVNPLFF-PQHTVLAAA
2509|chp|hut      -MGTVTTTIRSRIDIS-GATAILAVGDLVAIAAFVLIGAVYG-HGESLWN-VGRHVGTFL
10035|hp|hma      --MSVSTVGNGRIELS-ARTALVAVGDLLAIALFVGVGELTH-GINPILS-PGRFAGTLT
795|hp|hhi        --MSVSTVGNGRIELS-ARTALVAVGDLLAIALFVGIGELTH-GINPILS-PARFAGTLT
                             *             **.: :  .:  * :                 .  

3794|hp|nph       PFLLGWVICAPLIGAYSPGGGSAPNSSIPLAIRSWVPAAIVGFVVRYVALPQRGVEPVFI
2033|hp|hla       PFLIGWILVAPLIGAYSAGAVETAKSSVPLAIRSWIPAAVVGLALRHF-VFRGSAALTFA
2415|hp|hwa       PFLIGWVVISPLIGAYSAGAAESAKAAIPLAIRAWIPASIVGLGLRATPLFDGGVGITFV
13880|hp|hbo      PFLLGWGIFGVLIGAYSAGAAETAKASIPLTIRGWIPGAILGLGLRASPLFEGGFAWIFA
1362|hp|nrc1      PFLIGWLAAAPLVGAYSASTVASNRRAIVLAAGTWLAADLIGQLIRNTAAFPGNADPTFF
4290|hp|nph       PFIFAWVITAPLGGLYRPETVTSVRSALTKTTAVWVVASLAGGAIRGTEYFPGEAPAVFL
2509|chp|hut      PFLIGWLAASMLGSLYTTDARRSVLRAISWTVPAWITAALVGQLLRATTLFHGSFSPIFL
10035|hp|hma      PFYIGWLLVAGLGGLYTAAATATVRAALGRTLVGWVLAVGIAQGLRSTAMFPGSAALTFA
795|hp|hhi        PFYVGWLLVAGLGGLYTAAATGTVRAALGRTIVGWVLAVGIAQGLRSTSMFPGNAAVTFA
                  ** ..*   . * . * .    :   ::  :   *: .   .  :*            * 

3794|hp|nph       GIM---LVGGAVVISAWRFLYFKLR------
2033|hp|hla       AVM---LVLGSVVLGGWRALYFRFR------
2415|hp|hwa       AVV---LITGAIAVTATRWLFFLIIR-----
13880|hp|hbo      AVI---LATGMLALVAWRWLFFKIIG-----
1362|hp|nrc1      LVMFATVTAGLAIARFITLVVVDLRGS----
4290|hp|nph       VVN---IVFGLAFLLPWRLAVAYTLGR----
2509|chp|hut      LIS---TVVGLALLVPWRAGVAYWLGGGTLT
10035|hp|hma      LVS---VLVGGTLLLLWRGVIAVAK------
795|hp|hhi        LVS---VLVGGTLLLCWRGAIAVAK------
                   :       *