HOG Organism Gene ID Name Annotation
aHOG1189 hhi 1304 acs3 acyl-coenzyme A synthetase
aHOG1189 hhi 5273 HAH_5273 hypothetical protein
aHOG1189 hhi 4327 acs5 acyl-coenzyme A synthetase
aHOG1189 hbo HBOR16380 Hbor_16380 acyl-CoA synthetase/AMP-acid ligase( EC:6.2.1.1 )
aHOG1189 hla HLAC0990 Hlac_990 AMP-dependent synthetase and ligase
aHOG1189 hmu HMUK2056 Hmuk_2056 AMP-dependent synthetase and ligase( EC:6.2.1.1 )
aHOG1189 nph NP4240 acs_1 acyl-CoA synthetase I 1
aHOG1189 nrc1 VNG0484 acs1 acetyl-CoA synthetase
aHOG1189 hma Hma_10650 acs1 acyl-coenzyme A synthetase
aHOG1189 hma Hma_65217 acs2 acyl-coenzyme A synthetase
MUSCLE (3.6) multiple sequence alignment


5273|hp|hhi         ---MTDELRVHLH------------YTMRGSYPLRMVDVLFCTERA--------------
484|gene|nrc1       -MDSLDGVGTVVHEPDPALASSTNVAQFMTAHDIDDVDALRERSTTD--------LDWFW
4327|gene|hhi       MSDSLTALDEVRYEPSETFVTESNVYAFMQKHGIEDFEELHRRTVTDIDGEPASGLDWFW
65217|gene|hma      MSDSLTALDEVRYEPSETFVTESNVYAFMQKHGIADFEELHRRTVTDIDGEPASGLDWFW
990|gene|hla        -MDEYEGIDEIVHEPSEAFAESTNVAAFMREYGIDDYEDLIARTTSGIDGEPASGVDWFW
1304|gene|hhi       -MSEQDHVDSIVHEPSHAFVESTNVWEFMQEYDIDNYDELIERTTTDLPEEPESGVEWFW
10650|gene|hma      -MSEQDHVDSIVHEPSHSFVESTNVWEFMQEYDIDNYDELIERTTTDLPEEPDSGVEWFW
16380|gene|hbo      --MEVPDTDEVVHEPAREFVESTNVYEFMQEYGIEDYDELIRRTCTDVDGVAESGVEWFW
4240|gene|nph       MPAETPTQDEVVHRPDEEFVESTNVYQFMQEYGIDDYDELIERTTGD--------VEWFW
                                :              :   : :   : *                    

5273|hp|hhi         ----------YFVEYD--------------------------------------------
484|gene|nrc1       GELPEYLGLEFFEDYDAVRDDADDPQSTAWYPGAELNVAHNTVDRHASVDAGTRNHVACI
4327|gene|hhi       DEIVDYLDLEFYEAYEQVRDDTDGPQFTDWYVGGELNIAHNVVDRHAAPDSETRNTVATI
65217|gene|hma      DEIVDYLDLEFYEAYEQVRDDTDGPQFTDWYVGGELNIAHNVVDRHAAPDAANRNTIATL
990|gene|hla        DEIVDYLDIDFYTEYDAVRDDSGGPQFTDWYPGGEINVAHNVVDRHAAVDSPNRNRVALI
1304|gene|hhi       DLLPEYLDIEFFDAYDEVRDDSEGPQFTDWYPGGTINAAHNVLDRHAARDSPTRNTVALI
10650|gene|hma      DLLPEYLDIEFFDAYDQVRDNSEGPQFTDWYAGGTINAAHNVLDRHAARDSPTRNTVALI
16380|gene|hbo      DELVEYLDIDFYEDYDAVRDDTDGPQFSEWYPGGSINVAHNVVDKHAAPDSETRNNVALI
4240|gene|nph       DELPSYLDIEFYEDYDTVRDNSDGPQFTDWYPGGELNVAHNTVDRHA--DGERRNTVACI
                              ::  *:                                            

5273|hp|hhi         -------------------------YLTPVD-------------------LLFGSPDQRA
484|gene|nrc1       WEGEDGTVRQQTYHDLHQQANRVANALAERGIGEGDTVGLYMPMVPEVQSILYGIFKIGA
4327|gene|hhi       WEGENGTVREVTYHELHQQANRVANALEERGVGPGDTVGMYMPMVPEIVTLLYGCFKVGA
65217|gene|hma      WEGEDGTVREITYHELHQQANRVANALEARGIGPGDAVGLYMPMVPEIVPLLYGCFKVGA
990|gene|hla        WEGEPGDIREVTFHELARQTNRVANYLESVGIETGDTVGLYMPMVPEVVSILYGCLKVGA
1304|gene|hhi       WEGEPGDVREVTYHELNRQASKVANYLESVGVGTGDTVGLYMPMVPEVASILYGCLKVGA
10650|gene|hma      WEGEPGDVREITYHELNRQASKVANYLESVGVGTGDTVGLYMPMVPEVASILYGCLKVGA
16380|gene|hbo      WEGEPGDERKITYHDLHRESNRVANVLESYGIETGDTVGLYMPMVPEVVSILYGCLKVGA
4240|gene|nph       WEGEDGDVRNLTYHELQRQANQVANYLESRDVGVGDTVGLYMPMVPEVISILYGCFKAGA
                                              *   .                   :*:*  .  *

5273|hp|hhi         AAF-----------ASRVVE----------------EGVHAALETAETVETQS-------
484|gene|nrc1       IAVPIFSGFGVEATATRIADAECSVVFTGDGFLRRGDRVTLMDTLNDAIERAGH------
4327|gene|hhi       IAVPIFSGFGVDATATRIEDAECSVLFTGDGFYRRGSEIDLKSAADEAIEAAGH------
65217|gene|hma      IAVPIFSGFGVDATATRIEDAECSVLFTGDGFYRRGSEIDLKSAADEAIEAAGH------
990|gene|hla        IAVPIFSGFGTEATATRIADAEPSVLFTGDGFYRRGSEVRLKATADEAIEAAGH------
1304|gene|hhi       IAVPIFSGFGVDATATRIADAECSVLFTGDGFYRRGSGVHLKESADEAIKQAGEELGTTP
10650|gene|hma      IAVPIFSGFGVDATATRIADAECSVLFTGDGFYRRGSGVHLKESADEAIKQAGEELGTTP
16380|gene|hbo      IAVPIFSGFGVDATATRIEDSECSVLFTADGFYRRGGEVTLKDAADDAIAEAGH------
4240|gene|nph       IAVPIFSGFGVDATATRIADAECSVLFTGDGFLRRGSEVTLKDAADEAIAEAGH------
                     *.           *:*: :                  :       :::   .       

5273|hp|hhi         ------YDTLDK------------------------------------------IEVHSG
484|gene|nrc1       VDHTIVYDRLGI-----PADSLSW-TPRDEWWDDAVATQSPTFETHSMAASDPCMLLYSS
4327|gene|hhi       VEHTIVYNRLGS-----TESGLSWDSDRDEWWADAVGSQSADYETQSLPADHESMLLYSS
65217|gene|hma      VEHTIVYNRLGS-----TESGLSWDSDRDEWWTDAVGSQSDEYETQSLPADHESMLLYSS
990|gene|hla        VDDVVVYDRLGATPEGDAADPVPWNPDRDVTWTEAIESRSVDYETKRLPSDQESMLLYSS
1304|gene|hhi       VEHTVVYDRLGI--ADDPDETIRW-TRRDEWWDEAIETANDEYAAKELPSNQESMLLYSS
10650|gene|hma      VEHTVVYDRLGI--ADDPDETIRW-TRRDEWWDEAIATADDEYAAKELPSNQESMLLYSS
16380|gene|hbo      VEHTVVYDRLGF--EKREDRSIKW-RTRDEWWHETVAEADSTYETKELDSSQESMLLYSS
4240|gene|nph       VEHTVVFERLGA--------DVPWDDNRDEWWADAVGTQSDDYETKALGSSQESMLLYSS
                          :: *.                                           : ::*.

5273|hp|hhi         GRVGRPKITAHSHAGSATTV--RVHGQFDAEP----------------------------
484|gene|nrc1       GTTGTPKGIVHTHAGALVQPAKEIHFGFDQRPGDRFCWVSDIGWMMGPWSLIGNHAFAGT
4327|gene|hhi       GTTGKPKGIVHTHAGGLVQPAKEIFFSFDHKPADRFFWVSDIGWMMGPWTLIGNHAHGGT
65217|gene|hma      GTTGKPKGIVHTHAGGLVQPAKEIFFSFDHKPADRFFWVSDIGWMMGPWTLIGNHAHGGT
990|gene|hla        GTTGEPKGIVHTHAGVLTQCAKEIHFGFDQKPADRFFWVSDIGWMMGPWTLIGNHASGGT
1304|gene|hhi       GTTGKPKGIVHTHAGALMQAAKEIYFGFDHKPSDRFFWVSDIGWMMGPWTLLGNHAFGGT
10650|gene|hma      GTTGKPKGIVHTHAGALMQAAKEIYFGFDHKPSDRFFWVSDIGWMMGPWTLLGNHAFGGT
16380|gene|hbo      GTTGEPKGIVHTHAGVLMQCAKEIYFGFDHKPEDRFFWVSDIGWMMGPWTLIGNHAFGGT
4240|gene|nph       GTTGKPKGIVHTHAGTQMQAPKEVYFGFDLQPDDRFFWVSDIGWMMGPWTLIGTHTFGGT
                    * .* **  .*:***        :.  **  *                            

5273|hp|hhi         ---------------------------------FTQALRST----VDGHDVTV-------
484|gene|nrc1       IVMYEGAPDHPAPDRFWQLIEDHGITQFGVSPTAIRALRDHGDEHVAGHDLSSLRILGST
4327|gene|hhi       VFLYEGAPDYPEPDRFWEMIDTHNLSVFGISPTAIRSLQKHGDEWPDGHDLSTLRLLGST
65217|gene|hma      VFMYEGAPDYPEPDRFWEMIDTHNLSVFGISPTAIRSLQKHGDEWLEGHDLSTLRLLGST
990|gene|hla        VVMYEGAPDHPEPDRFWEMIDRHGITQFGISPTAIRALRKHGDEWVEDHDLSSLRILGST
1304|gene|hhi       VFMYEGAPDHPEPDRFWEMIDRHDLTTFGVSPTAIRALRKKGDEWLEGHDLSSLRLLGST
10650|gene|hma      VFMYEGAPDHPEPDRFWEMIDRHDITTFGVSPTAIRALRKKGDEWLEGHDLSSLRLLGST
16380|gene|hbo      VFMYEGAPDHPEPDRFWDMIERHGLTTFGISPTAIRALRKYGDGYVEQHDLSTLRLLGST
4240|gene|nph       MVMYEGAPDHPEPDRFWEMIDRHGVTQFGISPTAIRALRKRGDEWVEGHDLSSLRLLGST
                                                       .:*..        **::        

5273|hp|hhi         ------------------------------------------------------------
484|gene|nrc1       GEPWDPESWRWFYDHVGGGDTPIINISGGTEVFGCFLMPLPTESLKPCTLGGPGLGMDID
4327|gene|hhi       GEPWDPDSWEWFLENVGDGTTPIMNISGGTEIFGCFLQPTPLHSLKPGTLGGPALGMDID
65217|gene|hma      GEPWDPDSWEWFLENVGDGTTPIMNISGGTEIFGCFLQPTPLHSLKPGTLGGPALGMDID
990|gene|hla        GEPWDPESWRWFYDAVGGGDCPIINISGGTEICGCFLMPMPNQPLKPCTLGGPGLGMDID
1304|gene|hhi       GEPWDPESWQWFHEHVGNEDCPIINISGGTEIMGCFLMPMPIQSLKPCTLGGPGLGMDID
10650|gene|hma      GEPWDPESWQWFYEHVGDEDCPIINISGGTEIMGCFLMPMPTQSLKPCTLGGPGLGMDID
16380|gene|hbo      GEPWDPESWMWFYENVGGGDTPIINISGGTEICGCFLMPMPSQPLKPCSLGGPGLGMNID
4240|gene|nph       GEPWDPESWAWFYEEVGGGDTPIINISGGTEIFGCFLMPMPTQPLKPCTLGGPGLGMNID
                                                                                

5273|hp|hhi         ---------------------------------------------------------RQR
484|gene|nrc1       IVDDDGTSVRDANERGYLVARSSSPSMTRRLWSGEDRYLEAYWSRFED--VWNHGDWAQM
4327|gene|hhi       IVDAQGESVAEANEKGYLVCQSSAPSMTKSLWSGDERYLEEYWSRFGD--MWDHGDWAQK
65217|gene|hma      VVDAQGESVAEDNEKGYLVCQSSAPSMTKSLWSGDERYLAEYWSRFGD--MWDHGDWAQK
990|gene|hla        IVDESGESIKESGERGYLVARDSCPSMTKSLWSGDERYLKEYWSTWED--LWDHGDFAQK
1304|gene|hhi       IVDSDGESIADTHERGYLVARDSCPSMTRSLWSGDDRYLHEYWSTWDD--VWDHGDWAQK
10650|gene|hma      IVDSDGESIADTHERGYLVARDSCPSMTRSLWSGDDRYLHEYWSTWDD--VWDHGDWAQK
16380|gene|hbo      IVDSAGDSIADTHERGFLVARDSCPSMTKSLWSGDERYLKEYWSSFEDPPLWDHGDWAQK
4240|gene|nph       IVDETGASIKADNERGYLVARDSCPAMTKSLWSGDDRYLHEYWSSFQDPPMWDHGDWAQK
                                                                              * 

5273|hp|hhi         DGIGF-------------------------------------------------------
484|gene|nrc1       DADGDWFLHGRADDAINVAGRKVGPAEVEGALIDHDAVTQAAVVGVPDDTTGEAAIAYVI
4327|gene|hhi       DEDGFWFLHGRSDDVLNVAGRKVGPAEVESALIEHDAVNAAVAIGADDETKGTAVVTYVI
65217|gene|hma      DEDGFWFLHGRSDDVLNVAGRKVGPAEVESALIEHDAVNAAVAIGADDETKGTAVVTYVI
990|gene|hla        DADGFWFLHGRADDALNVAGRKVGPAEIEGVLIDHDAVNQAAAVGVPDDTTGTAVVAYVV
1304|gene|hhi       DEDGLWFLHGRSDDVLNVAGRKVGPAEVEGAAMEHDAVNQAAAVGAPDDTTGTAVVLYAV
10650|gene|hma      DEDGLWFLHGRADDVLNVAGRKVGPAEVEGAAMEHDAVNQAAAVGVPDDTTGTAVVLYAV
16380|gene|hbo      DEDGFWFLHGRADDALNVAGRKVGPAEIEGVLIEHDAVNQAAAVGVDDDTTGTAVVAYVV
4240|gene|nph       DEDGFWFLHGRADDALNVAGRKVGPAEVEGAAMEHEAVNQAAAVGVPDDTTGTAVVLYVV
                    *  *                                                        

5273|hp|hhi         ------------------------------------------------------------
484|gene|nrc1       LADAATPSAELRAELRDHVGDAHGKPFRPREVVFVDDLPKTQSGKLVRRAVASAYTGADV
4327|gene|hhi       LNEGFEESADLREALRAQVGRALGKPFRPREVRFVDEFPETQSGKIVRRIIQNVYEGAEL
65217|gene|hma      LNEGVEESADLREALRAQVGRALGKPFRPREVRFVDEFPETQSGKIVRRIIQNVYEGAEL
990|gene|hla        LEPHIEPSDDLREELRTLVGEEHGKPFRPRELLFVDAFPKTQSGKIIRRAIASIYKGEDP
1304|gene|hhi       LEPGYEPDDDLRDDIRAAVGEELGKPFRPREVLFVDEFPKTQSGKIIRRAIAGVYRGEDL
10650|gene|hma      LEPGYESNDDLRDDIRAAVGEELGKPFRPREVLFVDEFPKTQSGKIIRRAIAGVYRGEDL
16380|gene|hbo      LEDDVEPTDELREELRELVGEEQGKPFRPRELKFVSEFPKTQSGKIIRRAIAAVHQGEDT
4240|gene|nph       VEEGVEETDTLREEIRELVGEEQGKPFRPREVLFVDAFPKTQSGKIVRRAVEAAYTGEDL
                                                                                

5273|hp|hhi         -------------------
484|gene|nrc1       TDRSSIENPAVLDALRDAT
4327|gene|hhi       GDLSSIENPDAIDEIDNAR
65217|gene|hma      GDLSSIENPDAIDEIDNAR
990|gene|hla        GDLSSMENPKALDGLRDPN
1304|gene|hhi       GDMSSIENPDALDEVREAS
10650|gene|hma      GDMSSIENPTALDEVREAS
16380|gene|hbo      GDLSSIENPDALDEIRDAR
4240|gene|nph       GDLSSVENPGVLDDIEDAR