HOG Organism Gene ID Name Annotation
aHOG1186 hhi 2069 gcvPB glycine dehydrogenase subunit 2
aHOG1186 hbo HBOR08350 Hbor_08350 glycine dehydrogenase (decarboxylating) beta subunit( EC:4.4.1.16,EC:1.4.4.2 )
aHOG1186 hbo HBOR37880 Hbor_37880 hypothetical protein
aHOG1186 hla HLAC1610 Hlac_1610 glycine cleavage system P-protein
aHOG1186 hmu HMUK1896 Hmuk_1896 glycine dehydrogenase subunit 2( EC:1.4.4.2,EC:4.4.1.16 )
aHOG1186 nph NP4594 gcvP2 glycine dehydrogenase subunit 2
aHOG1186 nrc1 VNG1601 gcvP2 glycine dehydrogenase subunit 2
aHOG1186 hma Hma_11497 nifS glycine dehydrogenase subunit 2
MUSCLE (3.6) multiple sequence alignment


37880|hp|hbo        ------------------------------------------------------------
1601|gene|nrc1      ------------------------------------------------------------
1610|gene|hla       ------------------------------------------------------------
8350|gene|hbo       ------------------------------------------------------------
4594|gene|nph       ------------------------------------------------------------
2069|gene|hhi       ------------------------------------------------------------
11497|gene|hma      MPQTSSWRRSGRWRNDTRLALLGETPWDKPRPTSFTLDTGVSLRLALLGETPWDKPRPTS
                                                                                

37880|hp|hbo        ------------------------------MSVRRLTVDEA-------------------
1601|gene|nrc1      ----------------------------------MEHYEQARYAPAEGETNEPLLSENDQ
1610|gene|hla       -----------------------------------MIHDQADYARSDEDVHEPLLSEKDE
8350|gene|hbo       -----------------------------------MNYDQARYAR--EDQYEPLLAEKNS
4594|gene|nph       -----------------------------MSDDDPLGYDQARWMAD-EETYEPLLAEKST
2069|gene|hhi       --------------------------------MSRVKYDQARWTDDSDDRYEPLLSEKAS
11497|gene|hma      FTLDTGVSLRLALLGETPWDKPRPTSFTLDTGVSRVKYDQARWTDDSDDLYEPLLSEKTS
                                                          ::*                   

37880|hp|hbo        -------------------------------------AQRNWD-----------------
1601|gene|nrc1      TTVSV--DPSLPDDLTRDTVELPSLEEPELARHYVRLSQQNYGVDSGPYPLGSCTMKYNP
1610|gene|hla       TTVDVRESSPLPDELTREELTLPAPSEPEIARHYTRLSQMTWAIDSGPYPLGSCTMKYNP
8350|gene|hbo       TRVEI-DDSPLPDDLTRDSVELPDLSEPELARHYTRLSQMNWSVESGPYPLGSCTMKYNP
4594|gene|nph       ESVTV--DSTLPDELTRDELELPALSEPELARHYTRLSEMNYGVDSGPFPLGSCTMKYNP
2069|gene|hhi       ETVDT-EDSPLPDDLTRDSLSLPDPAEPELARHYTRLSQMNYGVESGPFPLGSCTMKYNP
11497|gene|hma      KTVDI-EDSPLPDDLTRDSLSLPDPAEPELARHYTRLSQMNYGVESGPFPLGSCTMKYNP
                                                         :: .:                  

37880|hp|hbo        --------DPEA--------------------LEELHVRRG----------------WAP
1601|gene|nrc1      RFTEDAAALPAAAVHPDRSETALQGTLAVMHDLQDYLGRIGGMDAVTLQPPAGAAGEFTG
1610|gene|hla       KFTEDVAVDPNAAIHPDRSARAAQGNLELQYRLQEYLGEIGGMDAVTLQPPAGAAGEFTG
8350|gene|hbo       SFTEDVAADPNAAVHPDRSVESSQGTLELLYDLQDYLGRIGGMDAVTLQPPAGAAGEFAG
4594|gene|nph       KFTEDVAADPKAAVHPARSEGTVQGVLALQHGLQEQLATIGGMDAVTLQPPAGAAGEFAG
2069|gene|hhi       SFTEDVAARADAAIHPDRPDSTVQGTLALCHRLQDYLGRIGGMDAVTLQPPAGAAGEFTG
11497|gene|hma      SFTEDVAARADAAIHPGRPDSTVQGTLALCHRLQDYLGRIGGMDAVTLQPPAGAAGEFTG
                             . *                    *::     *                :: 

37880|hp|hbo        ADIARKFQTD--------------------------------------------------
1601|gene|nrc1      ILIAEAYHEATDGGHRNEVIVPDAAHGTNFASAALGGYDVIELPSGDDGRVDLDALEAAL
1610|gene|hla       IAVAKAYHEH-HGNDRSEVVIPASAHGTNFATAALAGYDVVELPSGDDGRVDVEALEAAV
8350|gene|hbo       ILVAKAYHES-QGNDRSEVVIPASAHGTNFASAAMAGYDVVELPSGEDGRVDMDALDAAL
4594|gene|nph       ILMAKAYHEA-NGDDRTEVIVPDSAHGTNFASAAMAGYDVVTLPSADDGCVDLDALSAAL
2069|gene|hhi       IQIAKAYHQH-NGDERSEVVIPDSAHGTNFATAAMAGYEVVELPSGDDGRVDIEALEAAV
11497|gene|hma      IQIAKAYHEH-NDDERSEVVIPDSAHGTNFATAAMAGYEVVELPSGDDGRVDIEALEAAV
                      :*  ::                                                    

37880|hp|hbo        ------------------------------------------------------------
1601|gene|nrc1      GENTAALMLTNPNTLGLFERDIEPIAEMVHDAGGLLYYDGANLNALLGRARPGDMGFDIM
1610|gene|hla       GDDTAALMLTNPNTVGLFERDIAEIADIVHDAGGLLYYDGANLNALLGRGRPGDMGFDVM
8350|gene|hbo       SEDTAALMLTNPNTVGLFERDIVEIAEMVHDVGGLLYYDGANLNALLGRGRPGDMGFDIM
4594|gene|nph       SEDTAALMLTNPNTLGLFERDIESIAELVHDVGGLLYYDGANLNALLGRARPGDMGFDIM
2069|gene|hhi       GDDTAALMLTNPNTLGLFERDIEHVADIVHDAGGLLYYDGANLNALLGRARPGDMGFDVM
11497|gene|hma      GDDTAALMLTNPNTLGLFERDIEHVADIVHDAGGLLYYDGANLNALLGRARPGDMGFDVM
                                                                                

37880|hp|hbo        --------------------AATVREELK--------RQN-------LFQKDQSLPPKQG
1601|gene|nrc1      HFNVHKTFATPHGGGGPGAGPVGVTDELAGFLPDPHVRQS-AGGDYELYTPPRSIGKVHG
1610|gene|hla       HYNVHKTFATPHGGGGPGAGPVGVVDELAEFLPSPRVREADEGSGYEPFEPDNTIGKVHG
8350|gene|hbo       HYNVHKTFATPHGGGGPGAGPVGVVEELAPFLPSPRVRES--GGNYELFDPEETIGKVHG
4594|gene|nph       HYNVHKTFATPHGGGGPGAGPVGVTEELADFLPAPHVRET--DSGYERYEPDHTIGKVHG
2069|gene|hhi       HYNVHKTFATPHGGGGPGAGPVGVREELAQFLPNPHVRER--GGNYEHYEPDNSIGKVHG
11497|gene|hma      HYNVHKTFATPHGGGGPGAGPVGVREELAQFLPNPHVRER--GGNYEHYEPANSIGKVHG
                                        .. * :**         *:         :    ::   :*

37880|hp|hbo        L-----------------------------------------------------------
1601|gene|nrc1      FQGNWPVLVKAFAYIDRLGDSGLADASAKAVLNANYLADQLDYEIPLGPFHHEFVASAGD
1610|gene|hla       FTGNWLVLIKTYAYIARLGDEGLADAAAKAVLNANYLAERIDLDVPYGPFHHEFAATAGD
8350|gene|hbo       YMGNWLVLVKAYAYIARLGDAGLADASAKAVLNANYLAEQLDYEVPYSPFHHEFAATAGD
4594|gene|nph       YQGNWLVLLKAYAYIARLGDEGLTDASAKAVLNANYLATQVDYEVPFGPFHHEFVASAGD
2069|gene|hhi       FYGNWPVLLKTFAYIARLGDEGLRDASAKAVLNANYLAEQIEYEVPFGPFHHEFVASAGE
11497|gene|hma      FYGNWPVLLKTFAYIARLGDEGLRDASAKAVLNANYLAEQIEYEVPFGPFHHEFVASAGE
                                                                                

37880|hp|hbo        ------ARKLWEMGTDP--------------------------------------DAGGE
1601|gene|nrc1      QDAADVAKRMLDYGVHPPTTKWPELVAEALMTEPTETESKRTLDDLADAFNAVAGDDDAA
1610|gene|hla       RDAADVAKRMLDFGVHPPTTKWPEMVPEAMLTEPTEIEGQSSLDDLAEAFNLAYADSDEA
8350|gene|hbo       KDAADVAKRMLDYGVHPPTTKWPEFVPEAMLTEPTEIENRDSLDDLAHAFNAAMADSDEE
4594|gene|nph       QDAADVAKRMLDYGVHPPTTKWPDIVDEALMTEPTEIESKRTLDQLAAAFNAARADDADT
2069|gene|hhi       QDAADAAKRMLDYGVHPPTTKWPEIVDEALMTEPTESETKRSLDQLAAAFNAVAGDSDAE
11497|gene|hma      QDAADAAKRMLDYGVHPPTTKWPEIVDEALMTEPTEGETKRSLDQLAAAFNAVAGDSDAE
                          *..: : *. *                                      *    

37880|hp|hbo        KA------------------------------
1601|gene|nrc1      LADAPSRTTARRIDQTAAARNPRLSWHDLD--
1610|gene|hla       LGAAPNRTAASRIDQVSAARDPRLSWQALDGE
8350|gene|hbo       LENAPSRTTARRIDQVSAAREPRLSWHALDEE
4594|gene|nph       LAAAPERTAAGRIDQTSAARDPRLSWQALDDA
2069|gene|hhi       LADAPSRPAAKRIDQATAARNPRLSWQALDDT
11497|gene|hma      LADAPSRPAAKRIDQVTAARNPQLSWQALDDM