HOG Organism Gene ID Name Annotation
aHOG1185 hhi 2072 gcvT1 glycine cleavage system aminomethyltransferase T
aHOG1185 hbo HBOR08380 Hbor_08380 aminomethyltransferase( EC:2.1.2.10 )
aHOG1185 hbo HBOR37850 Hbor_37850 hypothetical protein
aHOG1185 hla HLAC1240 Hlac_1240 glycine cleavage system T protein
aHOG1185 hmu HMUK1892 Hmuk_1892 glycine cleavage system T protein( EC:2.1.2.10 )
aHOG1185 nph NP4774 gcvT glycine cleavage system aminomethyltransferase T
aHOG1185 nrc1 VNG1606 gcvT1 aminomethyltransferase
aHOG1185 hma Hma_11500 gcvT2 glycine cleavage system aminomethyltransferase T
MUSCLE (3.6) multiple sequence alignment


37850|hp|hbo        ---------------MSSDTDREIASTSRPALSKLEADHDDLVTRLRDGFESSEDLLFWL
1606|gene|nrc1      MPSRGTHQHTCLRKPYFPGRDGPRMGLRTSPLHGRHEDRGASFTEFG-GWNMPVDFDGIQ
4774|gene|nph       ------------------------MSLRTPPLFDAHTDAGAKLTEFG-GWEMPVEFDSIR
2072|gene|hhi       ------------------------MTLRAPPLSAVHQRSDASFTDFG-GWEMPVEFESIR
11500|gene|hma      ---MRRQQAVEGQTVRPRGTRGPRMTLRAPPLSAIHERADASFTDFG-GWEMPVEFESIR
8380|gene|hbo       ------------------------MALRKPPLREAHAARDAKFTEFG-GWDMPVEFDSIR
1240|gene|hla       ------------------------MSDRRTPLHEVHEERGAKFTDFG-GWQMPVEFASIS
                                                 ..*       .  .* :  *:: . ::    

37850|hp|hbo        QEVSV--ATLGCF------------PDEDLTDAFVESNSKACLIVGPDRHNTLLDEP-TD
1606|gene|nrc1      AEHAAVREAAGIFDVSHMGEIEVSGPDAERLMQRLTTNDVSRLDPGDAQYAAITDDDGIM
4774|gene|nph       TEHDAVRESAGKFDISHMGEIEVSGPDAAALTNRLTTNDVASLAPGEATYAGITDDDGVL
2072|gene|hhi       TEHEAVRSEAGKFDVSHMGQITVSGPDAATLTQRLTTNDVTVLDPGEAQYGAITDEDGIM
11500|gene|hma      IEHEAVRSEAGKFDVSHMGQITVAGPDAATLTQRLTTNDVTVLDPGEAQYGAITDEDGIM
8380|gene|hbo       TEHTAVRESVGIFDVSHMGEIEVSGPDATRLMQRLTTNDVTLLDPGDSQYAMITDAEGTI
1240|gene|hla       EEHAAVRDSLGVFDVSHMGEIEVSGPDATRLMNRLTTNDVTALDPGDSQYAAITNEDGVM
                     *  .     * *            **       : :*. : *  *   :  : :     

37850|hp|hbo        LQTAKRFRL--G---------------------FEETFLLPAF----RQSYRKLRKNANE
1606|gene|nrc1      IDDTVVYRTPAD---------------------WPGAFLFVPNAGHDAAAFDRWTDHRDA
4774|gene|nph       LDDTVVYRLPDG---------------------AT--YLFVPNAGNDELMAERWRSFADR
2072|gene|hhi       LDDTVVYRLPEG---------------------AADEFLFIPNAGHDGEMTERWLSERDE
11500|gene|hma      LDDTVVYRLPEG---------------------AADEFLFIPNAGHDGEMTERWLSERDE
8380|gene|hbo       LDDTVVYRLPDE---------------------ETDRYLFIPNAGHDEEMHDRWTSHRDE
1240|gene|hla       LDDTVVYRLPDGIEAGDGAGALAGLDRDLDAGAGDPAYLFVPNAGHDEQMYDRWVDYRDS
                    :: :  :*                             :*: .          .  .  : 

37850|hp|hbo        YVRPEDRPVTRATDPVALR----PALEELHERQRETI-EDVLGGFEDEEELLDWVRGLIG
1606|gene|nrc1      --HDLDASVDNVTTDYGMVAVQGPDAPDLVAARAGDG-VHDLGRFEAATVGVAGVECLVA
4774|gene|nph       --WDLAATVDNATDDYAMVALQGPDALELLSS-LDVD-VFDLSRFEAAERTVAGVDCLVS
2072|gene|hhi       --RGIDATVTNRTEEYAMIAVQGPDAPDLLAAETDVS-LAALSRFEVADGAVAGVDSLIA
11500|gene|hma      --RGLDATVTNRTEEYAMIAVQGPDAPDLLSAETDVS-LTALSRFEVAAGAVAGVDSLIA
8380|gene|hbo       --WELDARIANTTEEWAMFAVQGPDAKDAVVAAADGD-VGSLSKFEATYEDVVGVRSWVA
1240|gene|hla       --EGIDAAVANATDDWAMLAVQGPDAADALDDATPTDRVVDLSKFEATVAAVDEVDSWVA
                            : . *   .:     *   :             *. **     :  *   :.

37850|hp|hbo        AS--YGQIDRDVIT------------------------GLRMSDRVSRDNLLS----DPS
1606|gene|nrc1      NTGYTGEAGVEIVFPADGAGAVWDAIAN---DCQPCGLGARDTLRMEHGFLLSGQDFDPE
4774|gene|nph       RTGYTGEDGVELLFETAAAETVWSAL-----DCQPCGLGARDTLRLEAGFLLGGNEFDPE
2072|gene|hhi       RTGYTGERGFEILCPPDEAEAVWGAL-----ECQPCGLGARDTLRLEMGFLLSGQEFHPV
11500|gene|hma      RTGYTGEPGFEILCPPDDAGVVWDAL-----ECQPCGLGARDTLRLEMGFLLSGQEFHPV
8380|gene|hbo       RTGYTGEDGFEILCPVEEAETVWNAFVED-HESQPCGLGARDTLRMEMGFLLSGEDFDPE
1240|gene|hla       RTGYTGEDGFEVMCPAGDAETVWGAFVDAPRDAQPCGLGARDTLRIEMGFLLSGQDFDPE
                     :   *: . :::                         * * : *:. . **.     * 

37850|hp|hbo        MEYSLNDGKGSAW---FRKSLVAVQLLPAFNA--------GVRKLVDRA----GEETSEE
1606|gene|nrc1      ENPRTPFEAGIGFAVAPESGFVGRDALA--DTDSPEQQFVGLT-LDERGVPRHGYAVTTP
4774|gene|nph       TNPRTPYEANIGFAVDLGTEFVGSDALAAQREAGPDERLVGLR-LQDRGIARHGHDIVAA
2072|gene|hhi       DEPRTPYEAGIGWTVKLDTEFVGRDALEGVAADGPEEKLIGIE-LIDRGVPRHGYDVTTP
11500|gene|hma      DEPRTPYEAGIGWTVKLDTEFVARDALEGVAADGPEEKLIGIE-LVDRGVPRHGYDVTTP
8380|gene|hbo       SEPRNPYEAGVGFTVKLDTEFVGRDALEGIDEEGVEEKFVGLK-LLDRGVPRHGYDIVDA
1240|gene|hla       TEPRSPYEARIGFIVKLDTEFVGRDALEAQKEEGVDEQFVGIR-LLERGVPRNGYAVTDG
                     :         .:     . :*. : *             *:  * :*.    *      

37850|hp|hbo        EEDENGDV-------------------------GDHISV--------------------
1606|gene|nrc1      AGDEIGTVTSGTMSPTLGEPIGLGYVDSAHAADGTTVAVRIRGTDKQATITTPPFL-DQ
4774|gene|nph       -GDVVGEVTSGTMSPTLGAAIALGYVPVEYTEPGTELAVVVRGDEKDAVVEALPFY-E-
2072|gene|hhi       DGEPIGHITSGTMSPTLGAPIALAYVPTAYAQPDESVRVVVRGEPKKARTRSTPFL-DR
11500|gene|hma      DGEPIGHITSGTMSPTLGAPIALAYVPSAYAEPDKSVRVVVRGEPKKARTRSTPFL-DR
8380|gene|hbo       DNHVVGHVTSGTMSPTLGEPIALGYVPVEHADPGTTLSVVVRGQEKRAKVVSTPFLEDK
1240|gene|hla       DLTRIGQLTSGTMSPTLDEPIGLGYLHERYVEPGTEVSVVVRGDEKRAEVVIPPFI-DR
                         * :                         .  : *