HOG Organism Gene ID Name Annotation
aHOG1184 hhi 2070 gcvPA glycine dehydrogenase subunit 1
aHOG1184 hbo HBOR08360 Hbor_08360 glycine dehydrogenase (decarboxylating) alpha subunit( EC:1.4.4.2 )
aHOG1184 hbo HBOR37870 Hbor_37870 hypothetical protein
aHOG1184 hla HLAC1611 Hlac_1611 glycine cleavage system P-protein
aHOG1184 hmu HMUK1895 Hmuk_1895 Glycine dehydrogenase (decarboxylating)( EC:1.4.4.2 )
aHOG1184 nph NP4596 gcvP1 glycine dehydrogenase subunit 1
aHOG1184 nrc1 VNG1603 gcvP1 glycine dehydrogenase subunit 1
aHOG1184 hma Hma_11498 gcvP1 glycine dehydrogenase subunit 1
MUSCLE (3.6) multiple sequence alignment


37870|hp|hbo        ------MSMTEPPEDAGDRDAQSRLEE-ELDRPRGILTTADREYLTHPEGSLDLTEQTAR
1603|gene|nrc1      -------MSGSPYASPSEADTDAMLDAVGVDRVDELFDIPPEVSF---DGEFGIDAKSEQ
4596|gene|nph       -----MTANGSPYAPHTDAETEAMLSAVGVESEAALFDIPDSVRF---DDTFGIESRSER
2070|gene|hhi       MSDSDSHATGSPYAPQTAAETAAMLDAVGADDLESLFDVPESVAF---DGEFGIDARSER
11498|gene|hma      MSNSNSHATGSPYAPQTAAETAAMLDVVGADDLESLFDVPESVAF---DGEFGIDARSER
8360|gene|hbo       ------MTRGSPYAPHTDEETAAMLDAVGVEDEESLFDIPEDVRF---DGEFGIEARSER
1611|gene|hla       ----MSGTSGTPYAPHTDAETSAMLSAIGVDDEEALFDIPNAVAF---DGDFGIESRSER
                               *       :: : *.    :    ::  .    :   :. :.:  .: .

37870|hp|hbo        KRRSRIRERV--YNAILDFD-------YLAKLPED-ERRPVFEKVRDGWVNGTSSVALRR
1603|gene|nrc1      AALRGVRRRLSDNDDLTEFLGRGHYEHYVPSLVDSVSQRSEFITSYTQYQPEITQGFLQV
4596|gene|nph       DVRSLVDRQLGRNHDLTEFLGRGHYDHYVPSMVDDLAGRSEFLTSYTQYQPEIAQGFLQA
2070|gene|hhi       AARREVAGLLGRNADLTEFLGRGHYDHYVPSVVDDLASRSEFLTSYTQYQPEVAQGFLQA
11498|gene|hma      ATRREVAGLLSRNADLTEFLGRGHYDHYVPSVVDDLASRSEFLTSYTQYQPEVAQGFLQA
8360|gene|hbo       DIRSELATTFKKNQDLTEFLGRGHHSHYIPSLVDDITRRSEFLTSYTQYQPEITQGFLQA
1611|gene|hla       EIRAECSQIFARNDDIVEFLGRGHYGHYVPSVVDHLADRAEFLTSYTQYQPEISQGFLQA
                             .     : :*        *:..: :    *. * .    :    :.  *. 

37870|hp|hbo        LFKFVYLGLKSVGLERGFGNVLERAIEDAEKEFARGHGDHVEVDVTFDVEVESRTTSEEL
1603|gene|nrc1      LFEYQSLLVELTGLGVANCSMYDAATALAEAALLAKRVRAADGNRVLVPGFVRDSHVDVL
4596|gene|nph       LFEYQSMVAELTGLAIANCSMYDAATALGEAATLAIRVREADGDRVLVPEQLREGKRRTL
2070|gene|hhi       LFEFQSMLVELTGLGVANCSMYDDATALGEAATLSQRVRSVSGDRILVPEHLREGKRTVL
11498|gene|hma      LFEFQSMLVELTGLDVANCSMYDDATALGEAATLSQRVRSVSGDRILVPEHLREGKRAVL
8360|gene|hbo       LFEYQSILVELTGLPVANCSMYDAATALAEAARLAGRVRRVSGTQILVPEILHEGKRSVL
1611|gene|hla       LFEYQSMLVELTGLPIANCSMYDAATALGEAATLADRVRSTSGDAVLVPEHLREGKRAVL
                    **::  :  : .**  .  .: : *   .*      .   ..    :            *

37870|hp|hbo        EERYEEGEKLSLEEQSVLAREKDY----------------------GLTDEMMMDSPYFD
1603|gene|nrc1      RN-YTSGSDVVVERYATDAGNVDLDALEAAMDADVVMVYAENPTTCGTVEEQLCAVGDLA
4596|gene|nph       EN-YLIGHDVSVATYPMADGIADVDALDAAAGEETLAVYAETPTVRGVIEERLDEIGAIA
2070|gene|hhi       SN-YAEGPALTVESYPMTDGVVDVAALADQIGDDTAMVYAESPTVRGVIEERLGVVGDLA
11498|gene|hma      SN-YAEGPDLTVESYPMTDGVADVPALADEIGDDTAMVYAESPTVRGVIEERLGAIGDLA
8360|gene|hbo       DN-YVAGTDLTVETYPMDDGNVDLDAVAELADEDTAMVYAENPTVRGTIEEHLSDIGDVA
1611|gene|hla       EN-YCAGADLTVESYPMADGNADVDALADRAGDDVVMVYAENPTVRGCIEERLATIGGLA
                     : *  *  : :   .      *                       *  :* :     . 

37870|hp|hbo        PDRENP---GEAAFEAMMRDRAENLRAQ----DAPEEDIPE-FDEDMDL----PEHQRRV
1603|gene|nrc1      DSHDALFCLGSDPVAMSILQRPVDVGADVVVGDASVLGMPTSYGTGLGVFATRKEFLRQV
4596|gene|nph       TANDALFVVGSDPVALSLLEKPADVGADVVVGEAATLGLPAAYGTGMGLFACRESFLRQV
2070|gene|hhi       HDHEALFCLGSDPIALSLLERPADVGADVVVGDAASLGTGTAYGFGLGMFVTREEYLRQV
11498|gene|hma      HDHDALFCLGSDPIALSLLERPANVGADVVVGDAASLGTGTAYGFGLGMFVTREEYLRQV
8360|gene|hbo       DDAGALFCLGTDTVALALLEEPASVGADIVVGEADALGMPTAYGMGLGLFATRESFLRQV
1611|gene|hla       ADADALFTLGSDPVSLSVLQEPASVGADVVVGEAGALGLPTAYGMGLGIFACSDEFLRQV
                             *  ..   : : . .: *:    :*   .    :. .:.:     .. *.*

37870|hp|hbo        SPLIEGSMMATPIPQSIPMNFDQLYEDLSKVLV---------W-ALRDDIDKTDIGFEEF
1603|gene|nrc1      PGRLVGASEDDAGTRAFTLTLQTREQHIRKERATSNICTNQAWVALRAAIHAAWLGADGL
4596|gene|nph       PGRLVGASEDANGHRAYTLTLQTREQHIRRERATSNICTNQAWVALRTAMTIAWHGPDGL
2070|gene|hhi       PGRLVGASEDAADRRAYTLTLQTREQHIRKERATSNICTNQAWVALRTAMHAAWLGPDGL
11498|gene|hma      PGRLVGASEDAADRRAYTLTLQTREQHIRKERATSNICTNQAWVALRTAMHAAWLGPDGL
8360|gene|hbo       PGRLVGASEDAGGKRAYTLTLQTREQHIRKERATSNICTNQAWVALRAAMHAAYLGPDGL
1611|gene|hla       PGRLVGAGEDAAGDRAFTLTLQTREQHIRKERATSNICTNQAWVALRAAIHAATLGPDGL
                    .  : *:       .: .:.::   : : .  .         * ***  :  :  * : :

37870|hp|hbo        HDVQE--LMPNPVIIQTYYENAGDEFAID-EDDQLKEFVTLWD-------AVLAAAGWER
1603|gene|nrc1      VDLAERMVELPRDLAARLDDVSGVTAPVHDDRHHIREFQARTEQPAPAVASALEAEGFGV
4596|gene|nph       VDLAESCVVRAREAAERLDALDGVAAPVH-DRHHFREFLARTDQPARAVADDLAAAGYAV
2070|gene|hhi       VDLAEDCVTRARDLSDRLDDIVGVKAPIH-GRHHFREFLARTDQPASAIVADLASEGFAV
11498|gene|hma      VDLAEDCVTRARDLADRLDDIVGVTAPIH-GRHHFREFLAHTDQPASAIVADLAADGFAV
8360|gene|hbo       TDLAKQCVTDAASLASDLTELRGIKAPVH-DRHHFREFVAHTDQPAQAIASDLEAEGFAV
1611|gene|hla       VDLANDCVGEAAALADRIDDLSGAAAPVH-DRHHVREFAVRVDQPAAAIAGDLETEGFAV
                     *: :  :              *   .:     :..** .  :         * : *:  

37870|hp|hbo        PEGFDGLLEAMDFTPDKYDSERLDALLTELEGGR-
1603|gene|nrc1      HAVDDHTIQV---CVTDANEHATDAFVAAVREVSE
4596|gene|nph       HAVDDHLLQV---CVTETNADAIDGLVEAVTEAAR
2070|gene|hhi       HAVEDHLVQV---CATETTADATDEFVAAFREVAK
11498|gene|hma      HAVDDHLVQV---CVTETTTDATDEFVAAFREVAK
8360|gene|hbo       HVVGEHELQV---CITDLNAPKADELVAAFEEVL-
1611|gene|hla       HAIDEHLLQV---CVTDLNADRTDGLVAAFEEVI-
                        :  ::.      .      * ::  .