HOG Organism Gene ID Name Annotation
aHOG1181 hhi 218 lipA lipoyl synthase
aHOG1181 hbo HBOR02980 Hbor_02980 lipoate synthase( EC:2.8.1.8 )
aHOG1181 hbo HBOR37930 Hbor_37930 site-specific recombinase XerD
aHOG1181 hla HLAC2099 Hlac_2099 lipoic acid synthetase
aHOG1181 hmu HMUK0672 Hmuk_0672 lipoic acid synthetase( EC:2.8.1.8 )
aHOG1181 nph NP0562 lipA lipoyl synthase
aHOG1181 nrc1 VNG2216 lip lipoic acid synthase
aHOG1181 hma Hma_12959 lipA lipoyl synthase
MUSCLE (3.6) multiple sequence alignment


37930|gene|hbo      MGTGHFNKDRITHLERYRPLEPDQIPTWKEAAKDGKPIEELLGLTLLHTGIRRTTMAHMT
562|gene|nph        ----MSSRRRKPEWLRTRPPSGRRFTEIKETLRDRD----------LNTVCEEANCPNLG
2099|gene|hla       ----MQRGRRKPDWLKSRPPSGSRFTEIKERLRERD----------LHTVCEEANCPNMG
218|gene|hhi        ----------------MRPPSGERFTDIKQTLRDRN----------LNTVCEEANCPNLG
12959|gene|hma      -----MSRSRKPDWLKMRPPSGERFTDIKQTLRDRN----------LNTVCEEANCPNLG
2980|gene|hbo       -----MSGRRKPDWLKMRPPSGRRFTDIKQTLRDRD----------LHTVCEEANCPNMG
2216|gene|nrc1      -----MSSRRKPEWLKMRPPSGERFTDIKETLRDND----------LHTVCEEASCPNMG
                                     ** .  .:.  *:  .: .          *:*    :. .:: 

37930|gene|hbo      EAWLNLDDEENPHVKI---PPRQECTLGRGKQGSGGDTKNTGQPCYNC------------
562|gene|nph        DCWSGRDGPGTATFMLLGDRCSRGCNFCDVATG-GMDPLDPDEPANVAEAVAEIGLDYVV
2099|gene|hla       ECWSGRDGPGTATFMLMGDRCSRGCNFCDVETG-GMKSLDSDEPENVADAVAEIGLDYVV
218|gene|hhi        ECWSGRDGPGTATFMLMGDRCSRGCNFCDVETG-GMDPLDPDEPQQVADAVAEIGLDYVV
12959|gene|hma      ECWSGRDGPGTATFMLMGDRCSRGCNFCDVETG-GMDPLDPDEPQQVADAVAEIGLDYVV
2980|gene|hbo       ECWSGRDGPGTATFMLMGDRCSRGCNFCDVQTG-GMEPLDPDEPANVAAAVAEIGLDYVV
2216|gene|nrc1      ECWSGRDGPGTATFMLMGDRCSRGCNFCDVKTG-GMEPLDPDEPANVAESVAEIGLDYVV
                    :.* . *.  .. . :      . *.:     * * .. :..:*   .            

37930|gene|hbo      -----REKRPGYWKPKSHHGVRPIPIRE-------------------------------E
562|gene|nph        LTSVDRDDLDDGGAGHFAETIREIKRRDTSVLVEALIPDFQGDTDAVDRIIDADPDVVAH
2099|gene|hla       LTSVDRDDLADGGSEHFAETIREIQRRDPEILVETLIPDFQGDPEAIDRIIDAGPDVIAH
218|gene|hhi        LTSVDRDDLPDQGAGHFAETIRAIKERDPSILVECLIPDFQGEPELVRKIIDADPDVIAH
12959|gene|hma      LTSVDRDDLPDQGASHFAETIRAIKERDPSILVECLIPDFQGEPDLVRKIIDADPDVIAH
2980|gene|hbo       LTSVDRDDLPDQGASHFAQTIREIKQRDPSILVEVLIPDFQGDEEAVRKIIDAKPDVIAH
2216|gene|nrc1      LTSVDRDDLDDQGAGHFARTIREIKERDPSILVEVLIPDFQGEKSLVQKIIDAGPDVIAH
                         *:.  .    :    :* *  *:                                

37930|gene|hbo      DVEEILRNYFSVHDTVGGREKVNYYVEKISDRAD--------LGREVTPH-------DLR
562|gene|nph        NVETVERLQWPVRDRRAGYEQSLDVLRQIAAADGCYAKTSLMLGVGEYAHEVYRTLGDLS
2099|gene|hla       NVETVERLQWPVRDRRADYEQSLAVLDRVGRESDIHTKTSLMLGVGEYDHEVYRTLGDLS
218|gene|hhi        NIETVDRLQWPVRDRRAGYEQSLSVLRQVDRESDCYSKTSLMLGVGEYAHEVYQTLSDLR
12959|gene|hma      NIETVDRLQWPVRDRRAGYEQSLSVLRQVNRESDCYSKTSLMLGVGEYAHEVYQTLSDLR
2980|gene|hbo       NIETVERLQWPVRDRRANYEQSLSVLEQVKRESDIYTKTSIMLGLGEYDHEIYQTLSDLR
2216|gene|nrc1      NIETVARRQVPVRDRRAGYEQSLSVLEYVTRESDIYTKTSIMLGVGEYDHEVYQTLGDLR
                    ::* : *   .*.*  .. *:    :  :    .        **     *       ** 

37930|gene|hbo      N------TYGTRL--ARKGFTPHEIMH-----------------------LMGHSSIGIA
562|gene|nph        EVGVDIVTFGQYLQPSRSHLEVFEYVTPDTFDVWKRVAETEFGFLYCASGPMVRSSFKAG
2099|gene|hla       EVGVDVVTFGQYLQPSRSHLDVFEYVHPDVFETWRAVAEREFDFLYCASGPMVRSSYKAG
218|gene|hhi        QAGVDVVTFGQYLQPSRSHLEVSEYVHPDAFDTWQRVAEEEFDFLYCASGPMVRSSYRAG
12959|gene|hma      QAGVDVVTFGQYLQPSRSHLEVSEYVHPDAFDTWQQVAEAEFDFLYCASGPMVRSSYRAG
2980|gene|hbo       EADVDVVTLGQYLQPSRTHLDVFEYVHPDAFETWRQVAEDELGFLYCASGPMVRSSYKAG
2216|gene|nrc1      EAGVDVVTLGQYLQPSRSHLDVADYVHPQKFETWQRVAESEFGFLYCASGPMVRSSYKAG
                    :      * *  *  :*. :   : :                         * .**   .

37930|gene|hbo      RFYIKMSGTRLGLAYDEKW---------
562|gene|nph        ELFVE-ALERDGLDIEAARAAAERQ---
2099|gene|hla       ELFVE-ALLREGRSPEDARRHARAAGGD
218|gene|hhi        ELFVE-SVLREGQSADEARAKVRADN--
12959|gene|hma      ELFVE-SVLREGRSADEARAEVRAND--
2980|gene|hbo       ELFVD-AIVRDGKSVEQARREARTAAGS
2216|gene|nrc1      ELFVD-AVLREGKSVQEARRNARRAASE
                     :::. :  * *   :  .