HOG Organism Gene ID Name Annotation
aHOG1175 hhi 2620 HAH_2620 hypothetical protein
aHOG1175 hhi 900 pdhA2 pyruvate dehydrogenase E1 component subunit alpha
aHOG1175 hhi 217 pdhA1 pyruvate dehydrogenase E1 component subunit alpha
aHOG1175 hhi 4315 pdhA3 pyruvate dehydrogenase E1 component subunit alpha
aHOG1175 hbo HBOR02970 Hbor_02970 pyruvate dehydrogenase E1 component, alpha subunit( EC:1.2.4.4,EC:1.2.4.1 )
aHOG1175 hla HLAC0139 Hlac_139 pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit
aHOG1175 hla HLAC0731 Hlac_731 dehydrogenase E1 component
aHOG1175 hmu HMUK0674 Hmuk_0674 pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit( EC:1.2.4.4,EC:1.2.4.1 )
aHOG1175 nph NP0560 oxdhA_1 2-oxoacid dehydrogenase E1 component, alpha subunit 1
aHOG1175 nph NP2542 oxdhA_2 2-oxoacid dehydrogenase E1 component, alpha subunit 2
aHOG1175 nrc1 VNG2217 pdhA2 pyruvate dehydrogenase alpha subunit
aHOG1175 hma Hma_10149 pdhA1 pyruvate dehydrogenase E1 component alpha subunit
aHOG1175 hma Hma_12957 pdhA3 pyruvate dehydrogenase E1 component alpha subunit
aHOG1175 hma Hma_65200 pdhA2 pyruvate dehydrogenase E1 component alpha subunit
MUSCLE (3.6) multiple sequence alignment


2620|hp|hhi         ------------------------------------------------------------
731|gene|hla        ---------------------------------------MGENDVDDTGSATDPLADEDC
4315|gene|hhi       ----------------------------------------MKNEAGSKDVPAAVREDSDL
65200|gene|hma      --------------------------------------MNMKNEAGSTDLPAPVREDSDL
2542|gene|nph       --------------------------------------------MDTADAIDAFAEGENL
900|gene|hhi        -----------------------------------------------MATDVLDRAYDDQ
10149|gene|hma      -----------------------------------------------MTQDVLNRAPDDR
2217|gene|nrc1      MALVLPNQSTETGQWVEIRWQRSPWKRLLRKSYSRRGRSSAHVRTGVPVTETIHRAPDDT
2970|gene|hbo       -------------------------------------------------MSVLQRDPQDM
139|gene|hla        -----------------------------------------MYEEVGSTVSVFDRAYDDP
560|gene|nph        -------------------------------------------------MSTLQRDPRDR
217|gene|hhi        -------------------------------------------------MSVLQRDPADR
12957|gene|hma      -------------------------------------------------MSVLQRDPTDR
                                                                                

2620|hp|hhi         ---------------MPS---------------------------RRTVLGTIACTLVTG
731|gene|hla        YRVLGPDGIPLPDATVPDLSDERFRAIYRDLVTTRRFDERAVSLQRQGRIGTYAPCAGQE
4315|gene|hhi       VQVLDAEGNVLPQASVPDISDRQLLELYETIKFARHFDQRAISFQRQGRLATYAPMTGQE
65200|gene|hma      VQVLDAEGNVLPQASVPDISDRQLLEMYETIKLARHFDQRAISFQRQGRLATYAPMTGQE
2542|gene|nph       HRRLDADGQPLVDGYEPPLSDDRLRELHRDMRLARHFDERMVSLQRQGRIGTYAPLAGQE
900|gene|hhi        AQALDADGEIVDPDLIPDLSDEKLVSMYRDMRFARQFDERMISLQRQGRLGTYSSLAGQE
10149|gene|hma      IQALDADGEIVDPDLIPDLSDEALVSMYRDMRFARRFDERMISLQRQGRLGTYSSLAGQE
2217|gene|nrc1      YRVLDENGELVDGAEVPDLTDDELVEMYRYMKLARRFDERAVSLQRQGRIGTYPPLSGQE
2970|gene|hbo       LRVLDEDGEPVGE--VPDLSDDELVRMYREMWMARHFDTRAVSLQRQGRMGTYPPLSGQE
139|gene|hla        VRVLDEGGEVVGD--VPDLDDEALVEMYRDMRLARHFDGRAVSLQRQGRMGTYPPLSGQE
560|gene|nph        VQVLDEDGQVVAEDGVPDIDDETLLEMYRTMRLARHFDERAVSLQRQGRMGTFPPMSGQE
217|gene|hhi        VQILDEDGTVVDGATVPDLSDDELVEMYRYLKLGRHFDQRAVSLQRQGRMGTYPPMSGQE
12957|gene|hma      VQILDEDGTVVDGATVPDLSDDELVEMYRYLKLGRHFDQRAVSLQRQGRMGTYPPMSGQE
                                    *                            *.  :.* .      

2620|hp|hhi         CSGLGDDSSTEEA-------------------------------TATATPTPVVLSPID-
731|gene|hla        GSAVGSTHALADRDLISYQYREHGAIVVRDL-LSEYLPYWLGHESGTEAIADGNVFPLNI
4315|gene|hhi       GSQVATSLALAEQDWLFPTYREHAAKYAHGMDLASLFEPLRGYREGYAIPDDVNVMPEYI
65200|gene|hma      GSQVATSLALAEQDWLFPTYREHAAKYAHGMDLVSLFEPLRGYRDGYAIPDDVNVMPEYI
2542|gene|nph       AAQFGSMYALDDDDWVSYQYREHGAVIDRG-GLADYIRYWMGYESGNATLVEHNIAPLNI
900|gene|hhi        GSQVGSTYALADEDTIFYQYREHGALVARGLPW-EYVLYWMGHEAGNAALGDVNVFPLNI
10149|gene|hma      GSQVGSTYALADEDTIFYQYREHGALVARGLPW-EYVLYWMGHEAGNAALGDVNVFPLNI
2217|gene|nrc1      GAQIASAMALADDDWIVPSYREHGASLVRGLPLKDTLLYWMGDERGNAIPAEENIFTVAV
2970|gene|hbo       GAQIGSAFALDEEDWMFPSYREHGAALHRGLPLKRTLLYWMGHEKGNRIPEDANIFPVAV
139|gene|hla        GAQIGSATALDEDDWMVPSYREHGAALVRGLPLKQTLLYWMGHEAGNATPEGVNVFPVAV
560|gene|nph        AAQVGSALALDADDWVFPSYREHAAAYVRGIDLDQTLQYWMGDERGSQTAA-ANVFPVAV
217|gene|hhi        ASQVGSAFALRDGDWAFPSYREHLAMYVKGWPLSDDLLYWMGSESGNSPPEDVQAFSFAV
12957|gene|hma      ASQVGSAFALRDGDWAFPSYREHLAMYVKGWPLSDDLLYWMGSESGNSPPEDVQAFSFAV
                     : ..   :                                    .          .   

2620|hp|hhi         --AAAVPETATVGVFSETTDALKTAIRDPSADVTAHE--------WAHVFHEFGCFAFDG
731|gene|hla        GIAAHLPHAVGAAWAFDYREE-DRVVAAHFGGGATSEGDFHEAMNFAGVFDTPTLFCCHN
4315|gene|hhi       PIATQVPQAMGMAWGHKLQGKTDTAVLCHLGDGATSEGDFHEGLNFAGVFDVPAVFVCNN
65200|gene|hma      PIATQVPQAMGMAWGHKLQGKTETAVLCHLGDGATSEGDFHEGLNFAGVFDVPAVFVCNN
2542|gene|nph       SIAAHVPHAVGMAWAAKLRGD-DRAVVCHFGDGATSEGDFHEGANIAGVFDVPAVFVCNN
900|gene|hhi        SIGAHLPHAVGWSWAAKRKGD-ERAGIVHFGDGATSEGDFHEAMNFAGVFETPTVFFCNN
10149|gene|hma      SIGAHLPHAVGWSWAAKKRGD-ERAGVVHFGDGATSEGDFHEAMNFAGVFETPTVFFCNN
2217|gene|nrc1      PIASQIPHATGMGWASQLKDESDTAFMCYFGDGATSEGDFHEGLNFAGVYDTPNVFFCNN
2970|gene|hbo       PISTQIPHATGAAWAKKLQGE-DSAVLCYFGDGGTSEGDFHEGLNFAGVFNTPNIFFCNN
139|gene|hla        PIASQVPHATGAAWASKLRGE-NDAFLCYFGDGATSEGDFHEGVNFAGVFDTPTVFFCNN
560|gene|nph        PIATQVLHATGVAWAADLKGD-DIVSLCYFGDGATSEGDFHEGLNFAGVFDLPAVFFCNN
217|gene|hhi        PIATQIPHATGAAWASKLKGD-DTAALVYFGDGATSEGDFHEGLNFAGVFDVPAVFFCNN
12957|gene|hma      PIATQIPHATGAAWASKLKGD-DTAALVYFGDGATSEGDFHEGLNFAGVFDVPAVFFCNN
                      .: :  :   .   .     . .     ..  : *         * *:     *   .

2620|hp|hhi         ETYAVA---ERTT------------GFGGY----INKYSVSEVDDPGNESTVRVD----D
731|gene|hla        NGWAISIPESRQTASDTFAEKAGAYGFEGIRVDGMDPLASYAVTKEAADRARRNED---D
4315|gene|hhi       NQWAISVPRERQTASETIAEKAQAYGIDGVRVDGLDPLAVYKVASAALEKAR-------N
65200|gene|hma      NQWAISVPRERQTASETIAEKAQAYGIDGVRVDGLDPLAVYKVASEALAKAR-------N
2542|gene|nph       NQWAISVPQAAQTASDTFAAKAEAYGFPGVRVDGMDPLATYEVMDEALDRAKSDDERPTD
900|gene|hhi        NQWAISVPRERQTASQTLAQKADAYGFDGVQVDGMDPLATYTVTEAARERAV-------G
10149|gene|hma      NQWAISVPRERQTASQTLAQKADAYGFDGVQVDGMDPLATYSVTEAARERAV-------G
2217|gene|nrc1      NQWAISVPREQQTATDTLAQKAAAYGFEGVQVDGMDPLAVYQVAHDAIEKAK-------D
2970|gene|hbo       NQWAISVPRERQTASATIAQKAKAYGFEGVQVDGMDPLAVYAATRAAVKKAK-------D
139|gene|hla        NQWAISVPRERQTRSATLAQKAEAYGIDGVQVDGMDPLAVYSVTKAAVEKAR-------D
560|gene|nph        NQWAISVPREQQSASATLAQKAHAYGFEGVLVDGMDPLAVYKVTREAVEKAHAADPSRDD
217|gene|hhi        NQWAISVPRERQSASETLAQKANAYGFDGVQVDGMDPLAVYQVTREAVEKAH-------D
12957|gene|hma      NQWAISVPRERQSASETLAQKANAYGFDGVQVDGMDPLAVYQVTREAVDKAH-------D
                    : :*::      :            *: *     ::  :   .   .   :        .

2620|hp|hhi         LPDSDRRAVIDAIDSGEHRYDSDVGGFDPNSSVYVHNGSYYVFSLAVHGDKPAEVTYAVE
731|gene|hla        SPVDAPRPAL--IEFLEYRFGAHTTADDP--TAYRDPDAVDPWRALDPLDRMEAFLRETG
4315|gene|hhi       PGPGELRPTL--IESVQYRFGAHTTADDP--SVYRDESEEEAWRDRDPVDRIETYLYNEG
65200|gene|hma      PGPGERRPTL--IESVQYRFGAHTTADDP--SVYRDESEEEAWRDRDPVDRIEKYLYNEG
2542|gene|nph       A-GTASRPSL--VEAVQYRFGAHTTADDP--SAYRTDEAVERWRRWDPLPRFEGFLREFG
900|gene|hhi        ADGQERGPVF--IEAVQYRFGAHTTADDP--DVYRDDAEVEQWRERDPLDRMEQFLRNCN
10149|gene|hma      ANGGEQEPIF--IEAVQYRFGAHTTADDP--DVYRDDAEVEEWRERDPLDRMEAFLRNCN
2217|gene|nrc1      PDEDEMRPTL--IEAVQYRFGAHTTADDP--SVYREESEVEAWKDKDPIPRLETFLVETD
2970|gene|hbo       PAEDERRPTL--IEAVQYRFGAHTTADDP--TVYRDSDEVEQWKQKDPIPRLETFLRDTG
139|gene|hla        PETDRPRPTL--IEAIQYRFGAHTTADDP--TVYRDDDEVESWKRKDPIPRLERYLRSEG
560|gene|nph        APGRACRPTL--IEAIQYRFGAHTTADDP--SVYRDDDEVERWKQKDPIPRLELFLRDRG
217|gene|hhi        PPEDGLRPTM--IEAVQYRFGAHTTADDP--SVYRDDSEVEHWKQKDPIPRMEAFLRDQG
12957|gene|hma      PPAGELRPTM--IEAVQYRFGAHTTADDP--SVYRDDSEVERWKQKDPIPRMEAFLRDRG
                           . :  ::  ::*:.: . . **   .*        :       .         

2620|hp|hhi         ATDSARCVTLEPLSLADAQAEALDTALR-----PDEAATITGEAARALIASDVPFVLRDG
731|gene|hla        RIDDDGVAAIHE-EADEIVADAIDFAESVE-PDPADMFDHAYADLPPELRRQRDELLAAV
4315|gene|hhi       ILDSDLESEIQD-SIEQEVSEAIETAEQTE-TSPDNIVEHVYEDVPARLEEQRDELNRLR
65200|gene|hma      ILDSDLESEIQD-SIEQEVSEAIETAEQTE-ASPDNIVEHVYEDVPARLEEQRDELNRLR
2542|gene|nph       LLDDEAVSAVES-DVEATVADAVDQAMAVE-PDPDDLFADAYAELPDDIKSQRAYLQRLR
900|gene|hhi        LLDDEKIDVMDD-TIDEQLGEIIDNAEAHA-AEPTDLFTDVYAESTQNIDEQQEYFEALR
10149|gene|hma      LLDDGKIDVMDD-TIDERLGEIIDNAESHA-PDPTDLFTDVYDESTSNIDEQREYFEGLR
2217|gene|nrc1      RLDDAAIESIEA-DIEDAVADAIEAAEETPRPDPASMFENVYAEMPQRLEQQLEYFQSIR
2970|gene|hbo       RLDDEKVDAIQS-EVEDEVAEAIKAAEAEPRPEPNEMFTNVFAEMTPEVQAQAEAFAELY
139|gene|hla        VLDDERVAEIET-AVETRVAEAIEAAESEVRPKPQEMFEHAYAELPPELERQYEEFAAFR
560|gene|nph        LLDDERVAAIEQ-SVTDEVADAVEAAESTERPAPDSMFDNVYADRPPELDAQQRQLDRLR
217|gene|hhi        LLDDERVDAIDE-SIQEEVATAIDEAEATERPEPEEMFADVYAEMPQRLEQQLDYLEDLR
12957|gene|hma      LLDDERVDAIDE-SVQDEVATAIDEAEATERPKPEEMFADVYAEMPQRLEQQLDYLEELR
                      *.     :         .  :. *       * .    .       :  :   .    

2620|hp|hhi         TCYELSPVDDTES
731|gene|hla        DEHGEGAFQREE-
4315|gene|hhi       EKYDDGAFSEVLE
65200|gene|hma      EKYDDGAFSEVLE
2542|gene|nph       EEYGDKALREEH-
900|gene|hhi        ERHGDDALLESE-
10149|gene|hma      ERHGDDALLESE-
2217|gene|nrc1      DEYGDEALLED--
2970|gene|hbo       EEHGDEGFLRE--
139|gene|hla        EAHGDEAFLEE--
560|gene|nph        NRYGDEELLE---
217|gene|hhi        ERHGDEVLLE---
12957|gene|hma      ARHGDEVLLE---
                      :    .