HOG Organism Gene ID Name Annotation
aHOG1173 hhi 2284 htr9 MCP domain-containing signal transducer
aHOG1173 hbo HBOR13970 Hbor_13970 methyl-accepting chemotaxis protein
aHOG1173 hbo HBOR26550 Hbor_26550 methyl-accepting chemotaxis protein
aHOG1173 hla HLAC2726 Hlac_2726 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
aHOG1173 hmu HMUK1755 Hmuk_1755 methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor
aHOG1173 nph NP1720 htr29 transducer protein htr29
aHOG1173 nph NP2610 htr30 transducer protein htr30
aHOG1173 nph NP2892 htr29 transducer protein htr28
aHOG1173 nph NP3212 htr31 transducer protein htr31
aHOG1173 nrc1 VNG0958 htr15 Htr15 transducer
aHOG1173 hma Hma_11752 htr15 MCP domain-containing signal transducer
MUSCLE (3.6) multiple sequence alignment


2610|gene|nph       MFDALRRLI--------PDTSSRTADGAADSGTDVPATD---------------------
3212|gene|nph       MVSGIFAQLAGVVDGSDTGGDRAENAGGNSESPGERLERVRTAVGYDDADAARLADETGA
13970|gene|hbo      MVSQLTTLVLG-------------------------------------------------
1720|gene|nph       -MTGLRDLFFSTLGT--TGGTETTDDGTDTPTDDI-------------------------
2284|gene|hhi       MFEQIRTYIYGQ-GSRSSDAAARRADGGLVASDGQ--TR---------------------
11752|gene|hma      MFEQIRTYIYGQ-GSRSSDATARRADGGFVASDGR--TR---------------------
2726|gene|hla       -----------------MNSGGNRLCGRLGEPHVE--MT---------------------
2892|gene|nph       MIRRLLRMVRGRTGQRLPDGGIQQDEASKIETAGD-------------------------
26550|gene|hbo      -------------MTTPTETPYRRSDT----------LS---------------------
958|gene|nrc1       MLRIFRKLLGRGAGTPATDGGTAASAVSFEDADDA--MA---------------------
                                                                                

2610|gene|nph       ---GGTAVSQQQLTAAYGDKADDKLLERTATQLSSTARGAASAGEIR---ETARAQAAAG
3212|gene|nph       IDGGERALSGDDIRSAYGTDVGDKLLAQQARDLNAVVGEADDTERMRRIASSARQQAAEG
13970|gene|hbo      --------------------------------------------------AVTGDADESS
1720|gene|nph       --------------------------------------------------DVPIDEQNGD
2284|gene|hhi       ---FLADAIDPDSPRLNDRFDDSEKAAIGTQHVERQFELEPDELR-----ELIDEYETAG
11752|gene|hma      ---FLTDAIDPDSPHLDDCFEDPDKAAIGTQHVERQFELGPDELQ-----ALIGDYEAAG
2726|gene|hla       ---GLRGLL----RRAFGRDRNSRSVPDGGVVVSDSADAGLSG-------DAPGDAAETE
2892|gene|nph       --------------------------------------------------SDAREQRAAD
26550|gene|hbo      ---GLRTWFSADAVAIFSNNISIENQRDTVISFVAKKEIMPNSLL-----TRLVDALPVG
958|gene|nrc1       ---GLQERY-----SVDQRDLDPTLPADAADHFDGLLDETAPTPE-----SYLPVYTAAD
                                                                                

2610|gene|nph       VAPSTYAGGYEFAARAAVKEAFDALEA------GASVTDARERALDGVSETMADLQQGLE
3212|gene|nph       IAPSSYVASHAPLFEDLIDDAFAAVQD------GGDPEEAKQDLKAAMRASLTGMAAGAD
13970|gene|hbo      SSA------------------------------------------SMLGEGGTDMDAG--
1720|gene|nph       ETT-----------------------------------------LGGRQSADEDL-----
2284|gene|hhi       ISQSEFIAAQGFVTESLVEGAFEQLRDELGPDAQAAIDSVEVELQEGLETTQSVSRAGVD
11752|gene|hma      ISQHEFVATQSFVTESLVEGAFDQLRDELGPDAQAAIDAVEAELHDGLQTTQSVSQAGVS
2726|gene|hla       TGTATSEGEEYTIAEA-----------------------------EGVDRAETLAAAGFE
2892|gene|nph       S--------------------------------------------DTTREMGTDTGTGLS
26550|gene|hbo      GGD-------------------------------------RPQPDGGVTSGHTETVSGVA
958|gene|nrc1       VSAGAFVDAYTTPADAVVDAVFQQLRE--GGVDGAAVDHAERQLKTGMHAVVEDAATGVA
                                                                                

2610|gene|nph       AFDAA----------------TVTVNEVIKAVPMSAILIDANHEVIAYT---GRLMGLDD
3212|gene|nph       EFDGSDTVEPLDESDYIE---ELTADDLFESIPYGVFLIDDENTMLGYNTAINRLLGLDA
13970|gene|hbo      -------------------------SVLLDALPMPAFVISATGVATGWNEAAERAFGIPK
1720|gene|nph       ---------------------DIAATALLDTLPQPAFIVDTNHRVAGWNREMEVLTGIER
2284|gene|hhi       AFTDSAADSGSGT--------GLDYHSVLHHIGTPLFILDTNGDILSWNRSIENLTGVSE
11752|gene|hma      AFTDSTADSNSSG--------GFDYHDILQHIGTPLFVLDPDGDILSWNSSIENLTGVSE
2726|gene|hla       --------------------------QVFNATGVPTFILDSEGNVAEWNESIASLTGNER
2892|gene|nph       TGRFV----------------DENVRLLLNGLSQPTFVLDAEGEVVAWNEALAELTGATR
26550|gene|hbo      R--------------------SLDSSQILEGVGAPTFILNDEGTVVAWNKQIERLTAVPA
958|gene|nrc1       AYETAAGPADDSSDGGTEEELNVDDDALLDSIGMPVFMLDATGSVVAWNETIEELTGCSK
                                               ::       :::.       :.       .   

2610|gene|nph       DHSEFVGEDCRETIAVATYSDRQRAKTLADKVAAAPHTAHE-EWDVERTDGANTLV--DF
3212|gene|nph       DHREFLGRDCRETLAAATYTDNSRHHALADKVVDAPRNADE-EWDVERREDTFSFIGNDD
13970|gene|hbo      E--KIIGASEEDATSMVSYDDDRAEKTLAHKVVDAPDTAHENDPSVERVRGP------SG
1720|gene|nph       E--AVLGT---DDTSELFRDD--RTETLADAVINDPDNADE-TFGAER-SGR------DQ
2284|gene|hhi       A--EAKEM---EMASMAFYPDGRRGKTLADKVLDAPETTHT-EYDVPKVEDE------EF
11752|gene|hma      A--EAKEM---EMASMAFYPDGRRGQTLADKVLDAPETTHT-EYDVPKVEDE------DF
2726|gene|hla       E--DAVGH---AHVSELFYPDGRRADTLADKVLDAPETADE-VYGVER-CDS------AQ
2892|gene|nph       D--EAVGH---DHASEMFYPDGRRAKTLADKVLEHPETVHE-EYDVEL-EAP------EM
26550|gene|hbo      S--VAVGS---EHASEAFYPDGRRAKTLADKVLEAPSNADK-TFGVAT-TGD------GG
958|gene|nrc1       A--DAMGM---DHASEAFYPDDRRVKTLADKVIESPRSAAA-EFDIER-SEE------KA
                                  :     *     :**  *   * ..     .               

2610|gene|nph       PVYRDRSVSKNKDGVEKHIEFLAVPIFDDGGELKAVLELIEDATEDIQREQDMVSLIEEV
3212|gene|nph       IVYGDTSVSVNTEGEETHIDFLAAPIFDDDGELRAVIELVEDRSEAVREQKELNGLVTEV
13970|gene|hbo      QFFVDERSLENADGERMYISFRALPIYDGD-ELVAVVELVEDKTEAQRQQEATHTLVNEV
1720|gene|nph       RAYEVEQELENADGETLHVHSVATPIFQSG-SLQGVVQLLQDNTEVIRRREAMADLVARS
2284|gene|hhi       TLYRDTSVMADQHGNERHISFSAAPIYDDDGELIAVVEMVQDRTDEANRHEAVTSLVDEI
11752|gene|hma      TLYRDTSVMADQHGNERHISFSAAPIYDDDGELIAVVEMVQDRTDEANRHEAVTSLVDEV
2726|gene|hla       TRYRDTSAMVDRHGDEKHIEFTAAPLYEGD-DLVGVTEVVIDRTENINQRNATEALVAEV
2892|gene|nph       GRVADTSTMLDQYGDEKHIYFAATPQYRDG-ELVGVVETVIDRTEEVERRLAIERLVGTL
26550|gene|hbo      --FEDSSTMVTGDGVERHIRFVAKPIFEGD-EVVAVVETIYDRTDVVAREQASVQLIDEL
958|gene|nrc1       QLYADTSVMTDQGGTDRHIRFKASPIFDDDGELLAVAETIEDRTEDVRRADAVEELVDEL
                                 *   ::   * * : .. .: .* : : * ::          *:   

2610|gene|nph       SATLGAIGDGDLTARADWE-DT-NGVIEPGLCDLVEDVNRMAGSFEELINGVDEKTHELE
3212|gene|nph       TDTLDSIGTGELSSRADFD-GD-DELVEDELLDVVEAVNGMAENFEQLVIRVEDQTEALA
13970|gene|hbo      TSTLEQIGEGNLDARAELG-SE-TEVLEDELLNIVAEVNRTGDRFESLVDEVESHATDVS
1720|gene|nph       KGTAESLEDGDLSARVEYT-DD-HEILDDEVLELAGAVNAIAETTQTMVSGLVDEIESLS
2284|gene|hhi       KSTMAALKNGRLDARASFDRTDGGEYVDDQLYEVVGSLNDMAEQVEQLADQVDAQAQQLA
11752|gene|hma      KSTMAALKNGRLDARASFDRTDVGQYVDDQLYEVVGSLNDMAEQVEQLADQVDEQAQQLA
2726|gene|hla       RETAEAIGEGDLDARAARR-EE-CEILDEELLSVIGVVNQMAENLQDLSEGVHEQAREID
2892|gene|nph       GSTLESLRSGELDARAELE-DEHAAALDDELLDVVDALNAFAEEFQTLSGRVEQQADRLD
26550|gene|hbo      LDTVGALANGDLSARIEFE-DE-SGRLPEEALSVVPEFNAMAERFERLADEVDQKAVHLG
958|gene|nrc1       STTIDALSSGQLSKRASFE-HE--GIINEQLVSVVSALNGMADQFERLVGQVDGQTQELA
                      *   :  * *  *           :     .:   .*  .   : :   :      : 

2610|gene|nph       ASIDQLGDASDRIDRTVEAQNDSLAEIGTEMENVSATMEEVAANAKEVTEAATRARETVA
3212|gene|nph       ESIARATDSAHSIDRQVEDQTESLEEVSNELESFSATMEEVAASSNEVATAAESALDNAE
13970|gene|hbo      NTITTANDAASQIDSRVTEQRKALEAVRDDLASFSAAMEEVAASSTEVESAADRARDNIG
1720|gene|nph       VAANRIADSAVEANEEIIEQNDSLRSINDEMQNLSATMEEVAASSDQVATAANRAEEAAV
2284|gene|hhi       TTIEQANSSAEAVESRVTEQTDSLTQAADNIQDIGAGMEEVAATSSEVASAAQRAKAAAE
11752|gene|hma      VTIEQANSSAEDVETRVTEQTDSLTEAADNIQEIGAGMEEVAATSSEVASAAQRAKAAAE
2726|gene|hla       RTVQKASTAAANIAENVDEQNELLEESVSEMQSFSAGMEEVAATADQVDSAAVAASEAAD
2892|gene|nph       DAVDRVVEAAAEISDAVGEQNELVDDAVSEMQTFSAQMEEVAATAQDVDEAASDAKETAE
26550|gene|hbo      KAIERAADAAMRIESQVTDQSELLDKGADEMQDLSASMEEIAATSDQVASSAAQAQTAAE
958|gene|nrc1       DTIERATADATDIADTVSSQNEMLSSAANEMENFSASMQEVAASSDQVASAAEQAQDAAE
                     :       :      :  * . :     ::  ..* *:*:**.: :*  :*  *     

2610|gene|nph       EGVEAGEKARESTDAVVESTDDLVDTVEQLGERMDEVGEVVDIIADIADQTNILALNANI
3212|gene|nph       RGVDSGQDAKAVTDEVNELSEQLVDSVAELDEYMAEIGEVVDIIADVADQTNILALNANI
13970|gene|hbo      SSLDWTVDTRKVTDEVKERSDDLLESVKRLEDDMEEIGDVVGLISEIADRTNILALNANI
1720|gene|nph       EGADAGESARAEMDAVVDTIDDLVETVERLESRMDAVDEVIEVIADIADETNILALNASI
2284|gene|hhi       DGSDAGEAVMDVTDGLAETSEDLVDTVTDLDDQMDEVSEIVEIIADVAEQTNMLALNANI
11752|gene|hma      DGSDAGEAVMDVTDGLAETSEDLVDTVTDLDDQMDEVSEIVEIIADVAEQTNMLALNANI
2726|gene|hla       EGLDASEDAREATEDVVDIGDELVESVGALSERMDDIEEVIEVISDVAEQTNLLALNANI
2892|gene|nph       HGLETGQDAREAAKEVTDISEELVDDITALQARMDDIESVVEVVSDVADQTNILALNANI
26550|gene|hbo      SARGAGESVRSATDNVIDISDDLLDSVIELQERMGSIEEVVEVIAEVADRTNLLALNANI
958|gene|nrc1       SGLEASEGANQATNEVIDISDDLMESVSKLESRMDEIEDVVEVIAEVADQTNLLALNANI
                     .      .    . : :  ::*:: :  *   *  : .:: :::::*: **:*****.*

2610|gene|nph       EAARAETDGDGFAVVADEVKTLASETRDHADEIADRIEEIQRQADDTIDGVERSAEQIAA
3212|gene|nph       EAARVDADGDGFGVVADEVKSLANETQQYTDEIRDRIETVQGQTDTTVEEVERTNDHIRE
13970|gene|hbo      EAARAGEAGEGFAVVAEEVKSLANETQSHTEQITERIDRIQSRADETVTLVEETHKDVGR
1720|gene|nph       EAARADEGGDGFEVVAEEVKALAEETKDNAEEISDRIVEIQEQTSETVDRTEETNERVRG
2284|gene|hhi       EAARAGESGSGFAVVADEVKTLANETSEYASEISTSITTIQDQASETAEMVETSHEQVEH
11752|gene|hma      EAARAGESGSGFAVVADEVKTLANETSEYASEISTSITTIQDQATETAEMVETSHEQVEH
2726|gene|hla       EAARAGEGGDGFAVVAEEVKKLADETRGYTEEITESLAELQAQSDETSTAVERSHERIED
2892|gene|nph       EAARADESGEGFAVVADEVKSLADETQSHTDDITDSIEKLREQTDRTVSAAMTSSERVDR
26550|gene|hbo      EAARAGEAGEGFSVVADEVKQLANQTHEHTEEIAQSIEQIQEQADETVMASEQSHEQIQV
958|gene|nrc1       EAARAGEAGSGFAVVADEVKELANETREHTERIAGSISDVQQQANETVLAVEESHEQIHR
                    ****.   *.** ***:*** **.:*   :. *   :  :. .:  *      : . :  

2610|gene|nph       TGDEIRRALDSLAAISDEVENTVDGISEVADANDDQAVRIEEVTATVAEARERADDVAET
3212|gene|nph       VREEIDESLSALDELSESIEDAAEGIQEVAEANDEQAATVEEVTATVDEVREQAHEVKQE
13970|gene|hbo      ADDAIDKTVSSLQEASDAVEEAADGVSELSRASDDQAESVEGVVSAVEDVSDDAAEIEES
1720|gene|nph       ASEEIEAMLDSLDDIVSAAQEAADGITEVAEVNDDQAASVEEITSTTEELNNRADEIETQ
2284|gene|hhi       AESEIADALDALDEISDAVEEATRGIQEVADANDDQASAIENVTSMVEDAQNHAQEAETA
11752|gene|hma      AESEIADALDALDEISDAVEEATRGIQEVADANDDQASAIENVTSMVEDAQNHAQEAETA
2726|gene|hla       AGTEIETVLDSLEEIADAVDEAAAGVAEVARTTDDQAATVEELTSSLEAVRERSDRTEDA
2892|gene|nph       ADQRIQEMFDAFEDIADAVEAAADGIAEVAQANDDQAASIEEVTATLETVREHSERAETA
26550|gene|hbo      ASGEIEDVLASLEEIAQATDAAADGIGEVARATDSQATNIEEVTTTIQTAQSHAFDARDA
958|gene|nrc1       AGDEIDDALTALEEIATSVDEAATGITEVARANDEQASTVEDVIVTIEDVQQQAEEAAAA
                    .   *   . ::       : :. *: *:: ..*.**  :* :        . :      

2610|gene|nph       TDAVVDAVEEQEAAVDDLSDRVAEL-R---------------------------------
3212|gene|nph       TNDIVEEAETQEAAVGTLSERVERL-STDATENDGDGFDETTAEDSDD------------
13970|gene|hbo      VDDIVSVTQTQRDSAGELGTMIDGL-SK--------------------------------
1720|gene|nph       IESITSLTEEQRDDIDDMVAHLNELAAGQAADAVDEA-----------------------
2284|gene|hhi       TKEIVKATDRQEEAVTELTDRVGEL-TNTN------------------------------
11752|gene|hma      TKEIVKATDRQEDAVTELTDRVGEL-TNTN------------------------------
2726|gene|hla       TERIVDATDDQEVAVDELITRVERLDARQERKREREQPQ---------------------
2892|gene|nph       AEDVESAATSQAESIDALIKRVERL-REGTADAADAA-----------------------
26550|gene|hbo      STEITDATADQTMALDELTDRVARL-CGGNVEATFEAGQIDIGTGDDAGDAGSSRTEITR
958|gene|nrc1       SDRIVSATQEQSTAVSQLSERVDKL-TTDSQ-----------------------------
                       : . .  *      :   :  *                                   

2610|gene|nph       ---------
3212|gene|nph       ---------
13970|gene|hbo      ---------
1720|gene|nph       ---------
2284|gene|hhi       ---------
11752|gene|hma      ---------
2726|gene|hla       ---------
2892|gene|nph       ---------
26550|gene|hbo      TDGGLDVDR
958|gene|nrc1       ---------