HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0117COG1994 COG0517KOG1764arCOG00607hypothetical protein

HOG Organism Gene ID Name Annotation
cHOG0117 nrc1 VNG2168 vng2168 no entry
cHOG0117 hmu HMUK1032 Hmuk_1032 peptidase M50
cHOG0117 hma RRNAC2755 hypothetical protein
cHOG0117 hwa HQ3066A metalloprotease
cHOG0117 hla HLAC2601 Hlac_2601 peptidase M50
cHOG0117 hbo HBOR28900 Hbor_28900 Zn-dependent protease
cHOG0117 hbo HBOR33690b Hbor_33690 Zn-dependent protease
cHOG0117 hut HUTA1508 Huta_1508 peptidase M50
cHOG0117 hvo HVO_0285 HVO_0285 SpoIVFB-type metallopeptidase transmembrane (TBD)
cHOG0117 nph NP0030A metalloprotease
cHOG0117 hhi 41 HAH_0041 peptidase M50
MUSCLE (3.6) multiple sequence alignment


30|gene|nph         ----------------MFKSFRVGSIADIPIKLDITLLLILPVLAFLIGSGMGEAVEAFE
2168|chp|nrc1       -----------------MRGFRIGRVFGIPIKLDVTFLLVLPVFAYLIGTQLEVWVSTLN
12755|hp|hma        MAVPPRGLKTVPRQPPDMRRFRIGSAFGIPIQLDLTFLLVLPLFAWIIGTQIEQTTELLN
41|gene|hhi         -----------------MRRFRIGSAFGIPIQLDLTFLLVLPLFAWIIGTQIEQTTELLN
1508|gene|hut       -----------------MRRFRIGSAFGIPIQLDLTFLLVLPLFAWIIGSQVGQSVELMN
3066|gene|hwa       -----------------MRGIRIGSAFGIPIKLDITFLLILPLFAWLIGNDIAQLTGIVN
28900|gene|hbo      -----------------MRGIRIGRVFGIPIQLNLTFLLILPLFAWLIGSDVGELVQVIN
2601|gene|hla       -----------------MRGIKIGTVLGIPVRLNWTFLIVLPLFAYLIGSQVGMIAEVMN
33690|gene|hbo      -----------------MRGFRVGSAFGIPVRLNWTFLIVLPLFAVFIAWDIAELVVVIN
                                     :. :.:*   .**:.*: *:*::**::* :*.  :   .  .:

30|gene|nph         QI--GAAFESPELLVAGWTPWLLGFVAAVGLFVCVLLHELGHAAVARHYDYGIASITLWL
2168|chp|nrc1       GAPFAAGLD-ATALTAGSVRWVLGAAAAVGLFVGVVLHELGHSVVAMRYDFTIDAITLWV
12755|hp|hma        GT-LNAGLD-VAVLTDGALVWVLGIGAALGLFTGVVLHELGHSLVAIRYGFPIDSITLWL
41|gene|hhi         GT-LNAGLD-AAVLTDGALVWVLGIGAALGLFTGVVLHELGHSLVAIRYGFPIDSITLWL
1508|gene|hut       DI-WGAGIP-VGPLATGQLPWVLGATAAVGLFTGVVLHELGHSVVAMRYGFPISSITLWL
3066|gene|hwa       DV-FGSAIV-ADPLTTGSTQWILGAATAIGLFICVLLHEFGHSLVAMYYGYTIDSITLWL
28900|gene|hbo      EL-FGSAID-AAALTSGSIPWVLGSAAAIGLFLCVLFHEFGHSLVAMHYGYEIDSITLWL
2601|gene|hla       EA-FSAGID-PAALGAGLTPWALGLAAALGLFGGVLLHEFGHSIVAMRYGYEIESITLWL
33690|gene|hbo      QL-FGATMD-PDQLTGGNLQWVLGLASALGLFTGVLLHEFGHSLVALRYGYEIDSITLWL
                         : :     *  *   * **  :*:***  *::**:**: **  *.: * :****:

30|gene|nph         LGGVARPEKQPEQWNHEFWIAIGGPVVSVALGIGCYLVYGFAGAEPVQSVLGVLTADSLR
2168|chp|nrc1       LGGVASLTDQPEEWDQELCIALAGPAVSVALAAVAYGVLAV--LPSS--------LDTVR
12755|hp|hma        FGGIAQLSEMPEDWKQELVIAIAGPIVSIAIGAVCFVAFQI--LPSGAGTI----VESTR
41|gene|hhi         FGGIAQLSEMPEDWKQELVIAIAGPIVSIAVGAVCFVAFQL--LPSGAATA----IESAR
1508|gene|hut       FGGIAQLDEMPEDWKQELFIALAGPIVSVALAGLSYAGFLL--VPTGDAVG----IASVK
3066|gene|hwa       FGGVASFTEMPERWQESLIIAVAGPIVSVGIGVIAYIGFITVPLPGS--------LEPAK
28900|gene|hbo      FGGVASFAEMPEDWRQELVIAVAGPIVSVALGVISFVGFVV--LPAT--------QGSVK
2601|gene|hla       LGGIASFTEFPEDWKHEFWIAIAGPVVSVAVGLVCYGVFVL--APLG--------SNAVL
33690|gene|hbo      LGGVASFTEFPENWRHELVIAIAGPVVSVLLGVGSYVAFIS--LPPS--------VDAVR
                    :**:*   . ** *  .: **:.** **: :.  .:                     .  

30|gene|nph         FLFGYLALLNIVLAAFNMLPAFPLDGGRVMRALLGRTRPFTEATKTAVAVGKFFAILFGI
2168|chp|nrc1       FVFGYLALMNLALAAFNLLPGFPMDGGRVLRALLARTRTFARATKIAAEVGKLFAFVLGI
12755|hp|hma        FILGYLALMNIALAAFNMLPGFPMDGGRVLRALLARRRSYARATTIAAEVGKIFAVFLGL
41|gene|hhi         FILGYLALMNIALAAFNMLPGFPMDGGRVLRALLARRRSYARATTIAAEVGKVFAVFLGL
1508|gene|hut       FLLGYLALMNFALAIFNMLPGFPMDGGRVLRALLARNRPFAQATQIAAEVGKLFALLLGL
3066|gene|hwa       FVIGYLALTNVLLAVFNMLPGFPLDGGRVLRALLARTRSHARATQIAAEVGKVFAFLLGI
28900|gene|hbo      FVLGYLALTNILLAVFNMLPGFPMDGGRVLRALLARRRSHARATKLAAEVGKMFAFLLGI
2601|gene|hla       FVFGYLALLNIVLAVFNMLPAFPMDGGRVLRALLARNQPHAQATQRAAAIGKVFAFFMGL
33690|gene|hbo      FVFGYLAILNIVLAAFNLLPGFPMDGGRILRALLARTQPHAKATQQAAAVGKVFAFGLGL
                    *::****: *. ** **:**.**:****::****.* ...: **  *. :**.**. :*:

30|gene|nph         FGLLMF-NPFLVAIAFFVYIAAAAEGRQTVLEAAFRGVRVADVMTPANEVRTVETTATLD
2168|chp|nrc1       AGLLSF-NVILIGVAFFIYIGAAGEAQRTAMNAAFEGVTVADVMTPASDVHTVAATASVA
12755|hp|hma        FGIFVLGNIFLAGLAFFIYIGAAGESRQTSMRAAFEGVTVADVMTPADHVTTVADDMSVR
41|gene|hhi         FGIFVLGNIFLAGLAFFIYIGAAGESRQTSMRAAFEGVTVADVMTPADHVTTVPEDMSVR
1508|gene|hut       FGLFGGGGLFLVAIAFFIYIGASSEAQMTTMKAAFEGVSVRDVMTPADRVQTVDPDLSVA
3066|gene|hwa       VGLFA--NLFLVALAFFIYIGASSEAQQTVMKAAFDGVTVGDIMTERSDLDVVEQNVSVA
28900|gene|hbo      FGLFY--NLFLVALAFFIYMGASSEAQQTVMKAAFEDVTVRDVMTPREKLDVVDIRTSIS
2601|gene|hla       IGLFTF-QLLLIVLAFFIYIAASGEAQQTTLKAAFEDVTVADVMTRREDLHTVTGDTSVA
33690|gene|hbo      LGLFT--NWFLIVLAFFIYIAASGEAQQTTIKAAFEDITVSDVMTSEENLETVSEETTIS
                     *::     :*  :***:*:.*:.*.. * : *** .: * *:**  . : .*    :: 

30|gene|nph         AILDRMFEERHTGYPVVEGGKLVGIVTLADIRNVHPEKRSETRVADVMSEDLEAVSPDTE
2168|chp|nrc1       DLMDSMLEHRHTGYPVFRDATAVGMVTLDDARSVRAVERDAMRVADVMSDDVYTIPGSAD
12755|hp|hma        ELIQTMFRERHTGYPVKRSGEVVGLVTLEDARAVQEVEREAYTVGDVMTTEIITISPETD
41|gene|hhi         ELIQTMFKERHTGYPVERGGEVVGLVTLEDARAVQEVEREAYTVGDVMTTEIITISPETD
1508|gene|hut       ELMELMFRERHTGFPVVDSGRVLGLVTLEDARAVREVEREAFRTEEVMTTDLRTIHPDEN
3066|gene|hwa       TLLERMFTERHTGYPVVDNGGLVGVVTLDDARSVEEVEREAYRVSDVMTPDVTTINPDAD
28900|gene|hbo      ELLDRMFYERHTGYPVVQNGRLVGMVTLNDARTVDEVERDAYIVKDVMSGELTTISPSAD
2601|gene|hla       DLMSRMFEERHTGYPVLHGGNLVGMVTLEDARSVRDVERDAYQVADVMETEVVGVGPEAD
33690|gene|hbo      DLLARMFTERHIGYPVMRNGDLVGMVTLDDAGAIEEVERDAYRVEDVMSTEPHTTSPDAD
                     ::  *:  ** *:**  ..  :*:*** *   :   :*.   . :**  :      . :

30|gene|nph         AMDAMRQLAQHSVGRLVVTDEFGNLAGLLTRSDLVTAMNVVQEKRL--------------
2168|chp|nrc1       ATDALDALQEHSVGRLLVVDADGEMVGLITRSDLMDAFGIIQSTGAAV------------
12755|hp|hma        VMDALTSLQQNSVGRLLVTDEDGSFEGLLTRSDIMTALSIIKSSSDYTAIG---------
41|gene|hhi         VMDALTSLQQNSVGRLLVTDEDDSFEGLLTRTDIMTALSIIKSSGDFTPIG---------
1508|gene|hut       AMTALTRMQEHNIGRLIVMEDD-EFVGLLTRSDLMTALSIIKESGRDTAMSGRALNGGVP
3066|gene|hwa       AMDAMQRMQENDIGRLPVIENT-ELVGLISRSDLMTALNIIKSRGSQTALT---------
28900|gene|hbo      AMDAITTMQQNGVGRLPVVDDEGELVGLISRSDLVTALNIIQSRGPSTSIR---------
2601|gene|hla       AMTALQTMQENGVGRLPVVDRSDELVGLISRSDLMTAFNIIQTGGTPSLISG--------
33690|gene|hbo      AMTAFQQMQQNGVGRLPVVNDAGDLVGIISRTDMMRAFNVIQSGGSPRMLQ---------
                    .  *:  : ::.:*** * :   .: *:::*:*:: *:.:::                  

30|gene|nph         ----SRGEEAAPR-----
2168|chp|nrc1       ----SRESLDLPSRP---
12755|hp|hma        ---ESETETVRPESRIER
41|gene|hhi         ---ETETETVRPESGIER
1508|gene|hut       TTMSHDERAGQDDRRFED
3066|gene|hwa       ----ERSSTSLPNAR---
28900|gene|hbo      ----PRDPTDVIEPR---
2601|gene|hla       ---RRQGAEGGPGVF---
33690|gene|hbo      ---SHGASEARELAQ---