HOG Organism Gene ID Name Annotation
aHOG1161 hhi 2340 HAH_2340 amidohydrolase 2
aHOG1161 hbo HBOR24370 Hbor_24370 predicted TIM-barrel fold metal-dependent hydrolase, COG2159
aHOG1161 hla HLAC0780 Hlac_780 amidohydrolase 2
aHOG1161 hmu HMUK3204 Hmuk_3204 amidohydrolase 2
aHOG1161 hut HUTA2903 Huta_2903 amidohydrolase 2
aHOG1161 nrc1 VNG0297 vng297 no entry
aHOG1161 hma Hma_11814 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


297|hp|nrc1        ----MLELEHGFRVVDCHARLHAG--PGRPSRGRTIEGEAFEREMHQAGIVRAVVFPGPR
2903|gene|hut      MVRSMLELEHGFRVVDTHVRLEPE-ADQRSGDGPG-TPERLEREMHQAGIVRSLVYPSAR
2340|gene|hhi      ----MLELEHGFRVVDVHARLEPD-EQRRPRDGMG-DPEQLEREMHQAGVVRSVVFPGER
11814|hp|hma       ----MLELEHGFRVVDVHARLEPD-KHRRPRDGMG-DPEQLEREMHQAGVVRSVVFPGER
780|gene|hla       ----MLGLEHDFRIVDTRATLDPD-ESSVATHGRDISPERLEREMLQAGVVRAVVSPGRR
24370|hp|hbo       ----MLELNHGFRVVDLHARLDPDSEEAVATRGREISAERLERELHQAGVVCAVVSPGRR
                       ** *:*.**:** .. * .      .  *     * :***: ***:* ::* *. *

297|hp|nrc1        KGEQGYLRANNAVAREAVKRPFVAFARIDGPRDPGRGAVAAVRNVAASRDDWQTTPEDIE
2903|gene|hut      EG--SYLKANNAIARMSVGRPFVALARLSGPRDPDSGTGARLRNLTASRNEDHTAPGEIE
2340|gene|hhi      DG--SYLKANNAVARMTVERPMVAFARVNGARDPGTGPGSTLRNLASSRTEEHTSPEDIE
11814|hp|hma       DG--SYLKANNAVARMTVERPMVAFARVNGARDPGSGPGSTLRNLASSRTDDHTSPEDIE
780|gene|hla       AAGRSYLRANNAVARLSIDRPFVAFARLNGPRDPRNGPLSAVRNLRAEREDHHARPDDVE
24370|hp|hbo       TEGEGYLRANNAVARMSVDRPFVAFARINGPRDPSGRASARLRNLTTSRDESHADPEDIE
                       .**.****:** :: **:**:**:.*.***   . : :**: :.* : :: * ::*

297|hp|nrc1        QYAYDDRFHGFKLDPAQDGLPDADVLDVLDDVGLPVLVDGGRQFTPAALAETLLDREFPV
2903|gene|hut      QFAYDDRFVGFKLHPAKDGLPDEAVIDALESVGLPVLVHGGEEFGPKAIERTLATADVPT
2340|gene|hhi      QYAYDDRFYGFKIHPPTDGLPDEEVLAELASVSLPVIVHGGEGFPPETVAESLLAYDFPV
11814|hp|hma       QYAYDDRFYGFKLHPPTDGLPDEDVLAELESVSLPVIVHGGEGFRPEAVAESLLAYDFPV
780|gene|hla       QYSYDDRFHGFTLVPHADGLPNEDVLTRLEAADLPLIVHAGRQFPPEAVERELLDYDMPI
24370|hp|hbo       QYAYDDRFHGFTLAPAVDGLPDEETLDQLENVGLPTLVHVGEAFTPDDAVETLLDRDFPV
                   *::***** **.: *  ****:  .:  *  ..** :*  *  * *      *   :.* 

297|hp|nrc1        VLGHFGGHPLDRELMTAAVELLESHESLYVDTAGVRYREILERAIREHPDRVVFGSGAPA
2903|gene|hut      IVAHFGGYPLDRERMDRTIDLLGAYDDLYLDTSFVRFREPLERALREHPDRILFGSGAPS
2340|gene|hhi      ILSHFGAHPLRRDLMERAIDLLETHDNLYLDTSAVRYRRPMERAILEHPDRVLFGSGVPS
11814|hp|hma       ILSHFGAHPLRKDLMERAIDLLETHDNLYLDTSAVRYRGPMERAVLEHPDRVLFGSGVPG
780|gene|hla       VLASFGGYPLDTDLMNETLDLLAEYDRLYVDTSAVRYREVLERGVLEHPDRVLFGSGAPD
24370|hp|hbo       IFAGFGGYPLNRDLMHRSIDLLDEYDDLYVDTSYVRFRGVMERALLEHPDRVMFGSGAPE
                   :.. **.:**  : *  :::**  :: **:**: **:*  :**.: *****::****.* 

297|hp|nrc1        THPNVSLMEVLTLDVTEDAMAKVLGQNLARILPAAASG---
2903|gene|hut      AHPSVAIMEILTLDVPEDAMRKAFSNNPGRVIDALAP----
2340|gene|hhi      VHPNVAVMEILTLDVPEDAMRKVFSNNPNRVIEALAP----
11814|hp|hma       VHPNVAVMEILTLDVPEDAMRKVFSNNPNRVIEALAP----
780|gene|hla       VHPNVGVMEVLTLDVSEDLMRRVFTKNPARLIPALAEGADV
24370|hp|hbo       AHPNVGVMELLTLDVSEDAMRRAFSKNAARVVTELGPGEQ-
                   .**.*.:**:*****.** * ..: :*  *::   .