HOG Organism Gene ID Name Annotation
aHOG1154 hhi 1626 HAH_1626 hypothetical protein
aHOG1154 hhi 1325 HAH_1325 hypothetical protein
aHOG1154 hbo HBOR13740 Hbor_13740 hypothetical protein
aHOG1154 hbo HBOR19610 Hbor_19610 hypothetical protein
aHOG1154 hla HLAC0299 Hlac_299 hypothetical protein
aHOG1154 hla HLAC1170 Hlac_1170 hypothetical protein
aHOG1154 hmu HMUK0170 Hmuk_0170 conserved hypothetical protein
aHOG1154 hmu HMUK2217 Hmuk_2217 conserved hypothetical protein
aHOG1154 hut HUTA0647 Huta_0647 conserved hypothetical protein
aHOG1154 nrc1 VNG1413 vng1413 no entry
aHOG1154 nrc1 VNG1533 vng1533 no entry
aHOG1154 nrc1 VNG2566 vng2566 no entry
aHOG1154 hma Hma_10672 hypothetical protein
aHOG1154 hma Hma_11000 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1170|hp|hla       ---------------MTDDAIDDRVGFEADG-RTLCIRDA-LEGEKFPLYFDREPQPQP-
13740|hp|hbo      -------------------MVTLTVTDTGVQAVGPDTATAVVTADGWSADDPSHELPRA-
1413|hp|nrc1      ------------------------------------------------------------
1626|hp|hhi       --------------------------MVTWGVAGERVDRNSSNTPEWDGETVDPSALVR-
11000|hp|hma      --------------------------MVTWGVAGERVGRDGGEALDWDGETADPTALVH-
2566|hp|nrc1      -----------------------MVVPLSDGHTGLALNDN-IYNRRVVMRTPTRVTPTP-
647|chp|hut       -------------METLPLSSTPRFEPLAAP-TGIQVVDP-IDGGQFTFLTPDPVETDP-
1533|hp|nrc1      --------------------MNPAFTPTTSP-TGLRVHDR-IENAQFELYTESRVAPTPI
299|hp|hla        --------------------MSIDIDPLSDA-AGLTVTDH-IENTQFEVYTDRPVEPAA-
19610|hp|hbo      MMEGFGDSESSPSFDSSETYLELSLDAASGG-DGVVVTDP-IERHQFELSTPSVIDPEP-
1325|hp|hhi       --------------------MTLTFEPLDDR-PGLAVIDQ-IERQRYRIHTPTPVALRE-
10672|hp|hma      --------------------MTLTFEPLDDR-PGLAVIDQ-IERQRYRIHTPTPIALRE-
                                                                              

1170|hp|hla       -------------------ALPDLFHVPVDRAVSFEAESVSIPAYSSVSLRDA-DGELVA
13740|hp|hbo      ---------------------------AVDSVGGVTTGLKLLPGVIRLRRLDS-ETERKL
1413|hp|nrc1      ------------------------------------------------------------
1626|hp|hhi       ------------QLHDREVTDGEQLPHRVDDCYSGSVTELALPAVDATVTRVA-TDTNTG
11000|hp|hma      ------------QLHNRESTDGEQLPRRVDDCYRGSVTELALPAVDAMVTRVD-TDADSG
2566|hp|nrc1      -------------------TDPSTFLFPVEEAARVHTDRLTTAKPSMVFLRDDATGDPLD
647|chp|hut       -------------------APKDALPVPVDGAVSIDTDVIRTPYLVGVWIRDG-EFDLVE
1533|hp|nrc1      ATGSGHGLSRQPDAEAWHTSSDAGFALPVDSAVAFDTTRITLPALVDVFVWQP-DRTLVG
299|hp|hla        -------------------SPEDAHYFPVDASVTVETGAIEIPRVAVVETRCG-DGTL--
19610|hp|hbo      -------------------TDPSAFWFPADAAVRFQTDQLELQTVVSVCIRDD-EGQMLG
1325|hp|hhi       -------------------AATDVFQYPVGDAVRIRTRAIELPTVVMVYVRDD-AGAIAA
10672|hp|hma      -------------------AAADVFQYPVGDAVRIRTRAIELPTVVMVYVRDD-DGAIAA
                                                                              

1170|hp|hla       RLN--ESMEFP-RATYFLDISS-V--------------TKAFVRIPDVSISATGMTDSGA
13740|hp|hbo      AAPVEGTVQLP-AAPYLLCVEG-A--------------VTIFIRF-DGEATMTG--AGGD
1413|hp|nrc1      ------------------------------------------------------------
1626|hp|hhi       AVDSPTTLE---EGEYLLTMEARAADSDRGSPLGVVDDIRIHVRF-DGPASLHS--AGIT
11000|hp|hma      TVDSPTTLQ---EGEYLLTMQARAADSDRESPLGVVDDIRIHVHF-DGPASLHS--AGIT
2566|hp|nrc1      ALTEPQSVTVSHDDPRLLEFQT-P--------------VRTYVRV-PGGTTTTVTMTLDD
647|chp|hut       QCTGGDQVSLP-DGRYVVEFSSVQ--------------LKLYLGI-DGPATVDA--TGDL
1533|hp|nrc1      KTTNQESATYPEQGAYALDVDIGS--------------MKLQLAV-TDPFEIHR--TDDS
299|hp|hla        -LTRGDSYAMP-AGTYHVGIDPAP--------------TKLYLAF-ASPFSVST--TERT
19610|hp|hbo      QTEHFASESFP-RATYSLELFA-P--------------VKTYVRV-NAPVTITS--DATQ
1325|hp|hhi       EVAQFESETLP-ADDYVLDPLT-Q--------------IKTYMRVEDTAVEVTV--DSDR
10672|hp|hma      EVAQFESETLP-ADDYVLDPLT-Q--------------IKPYMRVEDAEVEVTV--DSDR
                                                                              

1170|hp|hla       VELTFDGPTTVTVGARSLHTRPEATITVPDDPTALAEAVSVLGSSIKEFTPERSWPTLRG
13740|hp|hbo      PLLSFSDCRRVTVGVGDRSERPE-TVTVSQTPEGVATALSVMSAGHLTATPDRSRPEMRA
1413|hp|nrc1      ------------------------------------------------MGPARSLQSNRQ
1626|hp|hhi       SVLGFQEPTSITVGFVWETSAERPHLQVPATPAGLATAITHLSGAHHTMQPSRSHPELRG
11000|hp|hma      TVLSFQEPTSITVGFVWETNTERPHLQVPATPEGLATAITHLSGAHHTMQPSRSHPELRG
2566|hp|nrc1      VTVSFPDAHDLQIGVRSQHSHPIGEITTTTDPVDVMAAVEQFGAALQTPSPERSWPTLRG
647|chp|hut       VEFSTSGESDVVVGLRSYHEQPARTITTTESPHDVMKAISQFRGALKTTSPERSFPTLRG
1533|hp|nrc1      TVISFDATATVRLGARSLHTAPEATITITDDVRDGMRAVSLFGSALKTTTPERSFPTLRG
299|hp|hla        TRIDLDAPAEVTLGFRSLHQVPAGTIETPTDPESLMDAVSLLGSALQTTSPERSFPTLRG
19610|hp|hbo      TTISFDEETEVLVGARSHHKRPAATITTPDDPRSMMRAVSLLGSALKSTSPERSYPTLRG
1325|hp|hhi       TRIEFDAPTDLLIGARSQHDRPAATVTTTEQPTDVMAAVETFGSALKAYDPERSYPTLRG
10672|hp|hma      TRIEFDAPTDLLIGARSQHDRPAATVTTTEQPADVMAAVETFGSALKAHDPERSYPTLRG
                                                                    * **    * 

1170|hp|hla       YPPRIRVGDELDIPSPL--VAPDTGIEVVVRPTYADVYRLSTLAYYLGARVV--IGDAPA
13740|hp|hbo      SPPRIEFGSVTTIPDSVAARNPDSAVVFELPPSLDYLVPASSLAHYLGAEIRVADGADVS
1413|hp|nrc1      RPPAIAFGDTYSIPDAVANATPATGIEVRLPSSLRSVFVTAPLAFYLGATVTVAPDADPV
1626|hp|hhi       HPPIVTTGETTRIPEPVRQNRPETGITLRVPECEAELLVSAPLAYYLGAEVVVESRDAAL
11000|hp|hma      HPPIVTTGETTRIPEPVRQNRPETGITLRVPECEAELLVSAPLAYYLGAEVVVESRDAAL
2566|hp|nrc1      HPPRLTVGQPDSTTHSL--SRPDVDVTVGVPPELGAVYAVTPLAFYLGARLE--PSSTPS
647|chp|hut       HPPLVEFGEEFSAPGGA--RLSPASLSIELPPRWDRILPAAPLSYYLDADLV--PGDRAR
1533|hp|nrc1      HPPLVERGDAFDAPATL--DAPDTGIAIEIPPDWGDLYRVSTLAYYLGATVQ--PGAQRA
299|hp|hla        HPPLIEPGEEFRVPDRV--EPVDSGIRIVVPPEYRYLYPVVSLAYYFAADVV--PGDPPR
19610|hp|hbo      HPPLIERGEQFKAPPDL--APPETGITLELPATYRHVYVAAPLAYYLGATVV--EGDTPR
1325|hp|hhi       HPPALEVGDSLDIPTDI--DRPDTGVTLELPPDLASIFVAAPLSYYLGASLV--PASEPR
10672|hp|hma      HPPALEIGDTLDIPADI--DSPDTGVTLELPPDLASIFVAAPLSYYLGASLV--PASEPR
                   ** :  *.    .           : . :      :    .*:.*: * :         

1170|hp|hla       IRLD-TGYVESLPTEGLALEERVEELLRTWLFLDTLARTEGYVKSDRYEYEQ-VGPKLPF
13740|hp|hbo      PTLRTATLEHEFEPNP-RYQSAVASLLRRVFLLDCLVRGADSNGRDVAEMEL-L-DEVGL
1413|hp|nrc1      LRAPDHGVVWPLDDPP----TAVPAVLSRVFWLDCLVREATTDGPSATETAL-L-DDLDL
1626|hp|hhi       LTADGTSVHRSFDAWP-SLQAGVAALLRKVFYLDCLVR-----RVDPAESGARITSALSL
11000|hp|hma      LTADGTSVHRSFDAWP-SLQTGVAALLRKVFYLDCLVR-----RVDPAESGPRITSALSL
2566|hp|nrc1      VTAG--GHQIATFPRD-TLGRAAGALLKHVFTLDCVVRSVGLYDLDTPARDT-LTAAFDW
647|chp|hut       LHLD--GETVPLVGPD-GYEQRIAQILKHVFTLDCVVRTEGLYNVDLHERSV-LEARTDL
1533|hp|nrc1      LVLD--GVRYPFPSAS-GFGDAVQALLEHVFLLDCVVRTEGLYSVSMHERTA-IEPTLGI
299|hp|hla        IEGD--GWTHPLE--P-DFERRTGEVLRQAFHFDCLARTEGFYPVDLHERET---TDLDL
19610|hp|hbo      LRTD-SGFTYDLDTTA-GYEREVERVLKQTFFLDCLTRTEGYYQVELHERQA-VESDLDL
1325|hp|hhi       LTTD-TGFTYSLDTAR-GFESEVGRTLKRLFFLDCVTRTEGFHQIDLHERAA-IEPYVDL
10672|hp|hma      LTTD-TGFTYSLDTAR-GFESEVGRTLKRLFFLDCVTRTEGFHQIDLHERAA-IEPYVDL
                                            *   : :* :.*       .              

1170|hp|hla       ---YPPKLADLSMSERLMEYLEVDPETVEPYTPEWPTEAVLRPVPEAAELLPHLAHSLAP
13740|hp|hbo      ---DADSLSRSDIDERLEAYLDAPFAEISDRLPDWHLSMYVSPSYDRVRTLPYLLQNVPN
1413|hp|nrc1      ---DPARLAAASPAGRLAAYLETPFERVADRVPDWHLGMHVAPTYEHATTLPYLLDRLAL
1626|hp|hhi       ---DPDTVRSLSPAGRLERYIDVSDEAVNSILPEWPLSTYVSPEPERVRCLPFLLDRLSL
11000|hp|hma      ---DPDTVRSLSPAGRLERYIDVSDEAVNSILPEWPLSTYVSPEPERVRYLPFLLDRLSL
2566|hp|nrc1      TRDDLQRLYDMPLAARLQAYTEYPQETVLAAAPRWRHTVMVADDPRPIEHLSFLANDLAV
647|chp|hut       ---DFQRLYDLPLAERTLAYLDVPFETVEPATPEWKLTADVQPEPENARVLPFLSSDLAL
1533|hp|nrc1      ---DLSAAYDAPPAERLAAYLGVPFAVTEPHGPQWPVTADIAPDPGRIAALPFVVDGLAN
299|hp|hla        ---DWGRLYDLPLAERLGEYLAVPFERVEPELPQWTLTTDVRPDPENVELLPFVAGELSI
19610|hp|hbo      ---DFAALYDRPTAEQVEAYLQVPYETVAGHVPEWKLTTHVTPTPGNVELLPFVANDLAI
1325|hp|hhi       ---NFQSLYQQPLAEQVATYLQVPYDVIEDHIPKWRLTTHIDPVPANAEQLPYVVDDLAI
10672|hp|hma      ---DFQSLYQQPLAEQVATYLQVPYDVIEDHIPKWRLTTHIDPVPANAEQLPYVVDDLAI
                                 .   *            * *     :         *..:   :. 

1170|hp|hla       VRVRGSA--------------DPTADAPVALATSPWLP----------------------
13740|hp|hbo      IFLPEAK--------------PLGTDERLSRSLDDFYR--------ADNTAADEETAGNT
1413|hp|nrc1      VFPPETA--------------SLERQELVSRSLDDFYR----------------------
1626|hp|hhi       IYLPDSS--------------RLDQDELLDRTLSDSYL----------------------
11000|hp|hma      IYLPDSS--------------RLDQDELLDRTLADSYL----------------------
2566|hp|nrc1      VRTLPDA--------------TPDSAPALSAAVDEFMR------STTDT--------ASD
647|chp|hut       IRATGDDDI------------EPEDLSEASPDVESFFRDGPAMPDEPVLLRGAADVRSGT
1533|hp|nrc1      IRVHDAQPD------------TASDAGHGAEAVSSFLR------SRSQP--------DRD
299|hp|hla        VRSPETVTPAMASGGDGLGFFRAPRADTASLDRDEFVR------STAGTEPTRGADASAD
19610|hp|hbo      VRTPHTK--------------PSAGSTTQAEAVDAFLR------SSPQT-PNAGFTRSAT
1325|hp|hhi       VRTHQQQ--------------RLNQASVPAEVEAEFTR------DDVIT-RAA----SSD
10672|hp|hma      VRTHQQQ--------------RLNQASVPAEAEAEFTR------DDVIT-RAA----SSD
                  :                                                           

1170|hp|hla       -IEDAADPENTVPNPDTDPL---------SAGTAVLTPASYENR--LQRTTTARGDLDVV
13740|hp|hbo      RATKTVPGVTPVKPVLGPGRVHGWLADGVPIDVFKSISSAYEHR--ARYP-ANSQSLSVV
1413|hp|nrc1      GAPGPVASVEMVDPVDRPGRMQGWLADGIPVDAFKSHPASYRNHDEYQRD-ADRDAISVA
1626|hp|hhi       -SRGSAERPPVIEPNLREGQLHSWLAPGNPIDACKTPAEAYVNR--YRSQNRDADSQRVA
11000|hp|hma      -SRGSAERPPVIEPNLREGQLHSWLAPGNPIDACKTPPEAYVNR--YRSQNRDTDSQQVA
2566|hp|nrc1      TRGHGVIPDEFVAVPETDTMETSYIGPGVPVGNTKLIADAYDAR--FSHS--STDSVSVN
647|chp|hut       SSGESEVAERVFRPDPTDSLMHTFVGDGIPLGATKMTPEMFRRR--LEYEPVESGRVRVD
1533|hp|nrc1      QPRVAADADDVVVPPDTESIEHVWLADGVPVGANKATAADYQAR--LACDAPASDPIRVV
299|hp|hla        RGAVAADT-DFVRPEPVDTVEHAWVGAGVPLDANKATLDAYHRR--LEAGAVEQSRISVL
19610|hp|hbo      QSASLPER-SYVQPEKTDSLEQAWLGDGTPIGASKASLQAYRNR--LYRS-PTEGDIGIT
1325|hp|hhi       AATAPSEA-DYVEPQAEDSLEQAWIGDSIPIGASKLTKAAFEHR--LDRD-TNAEDITIR
10672|hp|hma      AGTATAET-DYVEPQAHDSLEQAWIGDSIPIGASKLTKAAFEHR--LDRD-TNAEDITIR
                             .                 . .        :  .              : 

1170|hp|hla       VLADSPDRAAAIRRVLSNPATP-DGIN-TWKVLDRPDAEQTAAVLSN-PDIDIVYCELPT
13740|hp|hbo      AVLNDRRMIDESTDAARIYESAPSELDLDVTVKKRITRAELAAVFES--HHDLVHYIGHC
1413|hp|nrc1      VVLNDRDMAGEHDAVADIYESRAGDLPIDVTLHERLTRTELTEVLTT--HHEFVHYIGHC
1626|hp|hhi       VVLNDEEMAGEHTEVTEIYRAA--DLPMDVQVSELLSVNELADVFEQ--PADFVHFIGHC
11000|hp|hma      VVLNDEEMADEHTEVTEIYRAA--DLPMDVRVSELLSVNELADVFRQ--PTEFVHFIGHC
2566|hp|nrc1      VVCNEDDMWDEYSEFSL-YGNR-DGLEFDVSVTRNATRAELADVLTSMGDTDFFHYIGHV
647|chp|hut       VIVNEEAMSDE-TAVSDVYGTR-DWIDFDVTIHSDLTQGELADVFQR--DTDFLHYIGHV
1533|hp|nrc1      VVCNDPSMDAE-DCVSAVYGMR-DFFEFDISVRHELSTSELATVLES--TVDFLHYIGHT
299|hp|hla        VVCNDEQMREE-GEVADLYGLR-DMVQFDIEVRHDLTREEMRETLQS--DVDFLHYIGHV
19610|hp|hbo      VVCNDPRMADEREDVEAVYGSR-EKLPFDVQVQYELTKDELREALAT--QTDFFHYIGHI
1325|hp|hhi       VVQNDARMDEERQVVDDVYGTR-DDLPFDVTVHDDLTTAELRTVLTT--DAEFFHYIGHT
10672|hp|hma      VVQNDARMDEERQLVDEVYGTR-DDLPFDVTVHDNLTTAELRTVLTT--DAEFFHYIGHT
                  .: :.                    .     :       :   .:      ::.:     

1170|hp|hla       -KGDRIAAGSEMVELDGLG---GAPALTVFEGTEETRLGVSVVENGGLSSIVA-ESVLDP
13740|hp|hbo      -DESGLRCPDGGLAITDLE-VSN-AQTFVLNACGSYYEGLELVEKGSVAGAVTFDKVLDR
1413|hp|nrc1      -AVDGLRCADGHVSVADLP-ALN-VETFFLNACGSFHEGLALVEGGSVAGAVTLRKVLDA
1626|hp|hhi       -DEEGLRCPDGNLALSSLS-EAR-TQTFFLNACGSYDEGLDLVKQGAVAGAVTLTDVLDK
11000|hp|hma      -DEAGLRCPDGNLALSSLS-EAR-TQTFFLNACGSYDEGLDLVKQGAVAGAVTLTDVLDK
2566|hp|nrc1      RDGTQFVCTDGALSFDQIAATTTPPRVFLLNGCSSYELGRAFIDAGSQAGIITVRPIGND
647|chp|hut       -DDEGFKCSDGYLDVRSLS-SVN-ISGFLLNACQSYVQGRALVDAGAVGGIVTLANIPNP
1533|hp|nrc1      -DATGFQCVDGRLDARDLD-TTG-VRAFLLNSCQSHAQGRALVDRGSQGGIVTVSDIDND
299|hp|hla        -DDRGMQCTDDYLDLTAEDLDVG-VSAFLLNACQSYQQGEALVHRGSRGGIVTLSDVANS
19610|hp|hbo      -DNDGFQCSDGTLDASTLS-DVG-MDAFLLNACRSYEQGMHLINAGAIAGIVTLEDVVNS
1325|hp|hhi       -EHDGFVCRDGKLDVTTVD-SVG-VDTFLLNACNSYNQGLALVEKGAIAGIVTLNEVLND
10672|hp|hma      -EHDGFVCSDGKLDVTTVD-SVG-IDTFLLNACNSYNQGLGLVEKGAIAGIVTLNEVLND
                       : . .  :               .::.  .   *  .:  *. .. ::   : : 

1170|hp|hla       PRIR---RLLGLLAVGVPVAASVGLSEGSNGVSTR--LIGDPSMEVA-SRKVIPKLLVSA
13740|hp|hbo      HAARVGTTFVRLLIRG------------------------TGAIPRPSGRGYAPSLWAPV
1413|hp|nrc1      QAAKVGTAFARLLLAGFPIALALRLARRRIRMGKDYAVVGDGTQTLAVTDDRETGVAHVD
1626|hp|hhi       HAALVGTAFARLLSNGFSIQRALELARRRIMMCKDYAVVGDGTYSIV-PNPAHPAVVWVS
11000|hp|hma      HAALVGTAFARLLSNGFSIQRALELARRRIMMCKDYAVVGDGTYSIV-PNPAHPAVVWLS
2566|hp|nrc1      AAMLIGQNIARFVNQGFSPRSALAIVQRYGRADDKYMVLGDGGYQVAQSKSGIPVVAHLT
647|chp|hut       TATSIGKTLARLLNSGFSIATARSFLEKDEQLAKRYMVVGDGYSNIVESQSGAPYYIEIE
1533|hp|nrc1      AAVRVGHAIARLLNDGFSLLAGLSVARNVTAFGNQYVTVGDGSAQVVQSRSGMPLLIELA
299|hp|hla        PATQLGRIIARLMNSGFNLRAALYVAKRELITGHQYIVVGDGGTTICHSRSGIALVLNLG
19610|hp|hbo      SAVEVGSMLARLLNQGFPIRSALGLVRGENAVGDSYIVLGDGGLAVAQSDGLYPNTCVIT
1325|hp|hhi       GAVRIGETVARLLNCGFPLRAALTIARGESILGGQYIVVGDGGVTVTQSEGGTPNMLEIA
10672|hp|hma      GAVRIGEAVARLLNCGFPLRAALTIARKKSVLGGQYIVVGDGGVTVAQTENGTPNLLDVS
                          .  ::  *                                     .      

1170|hp|hla       APGDSDD---LPITRVSLLSMPVQIGSEGSPVVECFSNRLELMGTQQVEKTTVKPAVLIE
13740|hp|hbo      YRSNGRSEFPTRTLIDRPPYRRVGIGRNGADSEPSYG-----GG-------------LSA
1413|hp|nrc1      AVDGGDQ---YRVAWTDHSMANHG-GGTPAPLLAGGNRR--LGG--NQVTFTASATELAR
1626|hp|hhi       --KGETG---FDVQCTVVSPERPG-ESYRLPFDDSAA----LNG--EQTSHSLGATELAD
11000|hp|hma      --EGETG---FDVQCTVVSPERPG-ESYRLPFDDSAA----LNG--EQTSHSLSATELAD
2566|hp|nrc1      T-ASSDSSQRYRFSVEMFPSEHDSLGGIYSPNFDALSQQ-LYAG--CTPTVTAAAQEVQS
647|chp|hut       G-NTRTP---IMFSIQGYPSPSLSIGGLRSWHSKSFGYDYINPT--RIEEMEMSKHEFDE
1533|hp|nrc1      --ATDAD---YELSLVGYPTANTPLGSLITPYVPGNDTPYLNAG--HIDTFSVATEDVRS
299|hp|hla        I-NESNS---WDLVAEGYPNGPYGVGTMSNLNLEKDECEHVIPF--QIHISDIKMEEIDY
19610|hp|hbo      --RTTEG---FNVDYRVYPGSHVGMCGLVIPLLPSVETHYLGSG--SVDSFTLSLEELND
1325|hp|hhi       --PNETG---FKLFMNMYPTDIDGLGSITMPLVEDYSYHHLSSG--EIGPLLLERPELED
10672|hp|hma      --ATTAG---YNVEMKAYSMDNKGLGAIVFPFFEECEEYFLAPG--SVGSFNISSSELSE
                                                                           .  

1170|hp|hla       LLNED-DSILQLNGTVILESDNLTE-----ADIEKVAKQNSADDVQATEIANWYSLD
13740|hp|hbo      YLTRQ-----YPKGQSVNAHA-RSV-----CLC------------------------
1413|hp|nrc1      TLPRV-DAPVVLDGQFYWADEAAAVVRPAQQNCGDFD--------------------
1626|hp|hhi       ALGQT-SLPVIFDGEFHWSDD-LAA-----RLRTDF---------------------
11000|hp|hma      ALGQT-SLPVIYDGEFHWSDD-LAA-----RLRTGF---------------------
2566|hp|nrc1      FLDLDSQMPVVLDGSLHWAPP-LEV-----SPCSTDP--------------------
647|chp|hut       FLSRE-DYPIFINDELTWSDD-FQI-----D--------------------------
1533|hp|nrc1      FFDQG-VFPVLYDGTLTWSDK-LTI-----EETG-----------------------
299|hp|hla        FLDLE-NTPIFFNDDLIWNDEPARL-----RALQQR---------------------
19610|hp|hbo      FLDLE-NIPLLVNGQLQWSDD-LDL-----DSL------------------------
1325|hp|hhi       FLLAQ-EVPVQFGEELYWSTS-LDL-----SEAT-----------------------
10672|hp|hma      FLQMQ-QVPVKADGDLYWSDS-MEL-----EDIS-----------------------
                   :