HOG Organism Gene ID Name Annotation
aHOG1153 hhi 105 HAH_0105 hypothetical protein
aHOG1153 hhi 4074 HAH_4074 hypothetical protein
aHOG1153 hbo HBOR07540 Hbor_07540 hypothetical protein
aHOG1153 hbo HBOR32460 Hbor_32460 hypothetical protein
aHOG1153 hbo HBOR33350 Hbor_33350 hypothetical protein
aHOG1153 hbo HBOR33770 Hbor_33770 hypothetical protein
aHOG1153 hla HLAC2514 Hlac_2514 putative transcriptional regulator, ArsR family
aHOG1153 hmu HMUK0344 Hmuk_0344 conserved hypothetical protein
aHOG1153 hmu HMUK0426 Hmuk_0426 conserved hypothetical protein
aHOG1153 hut HUTA2180 Huta_2180 putative transcriptional regulator, ArsR family
aHOG1153 hut HUTA2925 Huta_2925 conserved hypothetical protein
aHOG1153 nrc1 VNG0725 vng725 no entry
aHOG1153 nrc1 VNG2230 vng2230 no entry
aHOG1153 hma Hma_12826 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


4074|hp|hhi        ------------------MMCCPDCRR------------------------PRSASACVD
33350|hp|hbo       MADLGGSS-------------------------------------------YDDTYAALT
2925|chp|hut       MAVWDHVRP---------MADDQGSAV------------------------AEDAFALLG
32460|hp|hbo       ------------------MSPRVPAAE------------------------LDSVFGLLA
2230|hp|nrc1       -----------------------MTDD------------------------AEAAFSAVA
33770|hp|hbo       MTDTTSSDSSKAESGDTSETDSDDSSE------------------------PDAAFAAVS
2514|gene|hla      MSQFDRTAGADAGAETDTATETEPAAETDAGSDIDSDDDLTAALRTESRVLPAEVFATLG
2180|chp|hut       MSQFDRTKESGHESGAGTETGPGPART-------------------ESRIPPAEVFSILG
105|hp|hhi         -MRVDESPETD------------ADID------------------------PATAFSVIA
12826|hp|hma       -MRVDESPETD------------ADID------------------------PATAFSVIA
7540|hp|hbo        MSETDAAEDRL-------LTDCVDCLD------------------------PAEAFAVVG
725|hp|nrc1        MSGSEQSPDPDTPQSASSATQDDDGLA------------------------AADAFALLG
                                                                         . . : 

4074|hp|hhi        KRYYVD----------GQAHDP-----------IPWGE--------GSQYLAYKLQVLQ-
33350|hp|hbo       DETRVQILFAL--ADQYDEAWSSGW--------LSFSQLRERVGVADTSRFSYHLDALQD
2925|chp|hut       HEIRLDILRAL--FDRYEPIDPTSGPELRDRRTLSYAELMDATGVQDSGKFNYHLEKLRG
32460|hp|hbo       NELRIEILRTL--WA--QHPES-----------LSFSDLRSSVDIRDSGKFNYHLDVLVP
2230|hp|nrc1       DELRVRILREL--W---DADDP-----------LSFSELRECVDVQDSGRFNYHLGELRG
33770|hp|hbo       DPTRIAILRELGSHARETGEET-----------VGFAALRKRAGVEDSGRFRYHLNTLIG
2514|gene|hla      NDTRVDILRAL--LELGADEEP-----------VSFTDLFERVDIDDSANFNYHLRQLTG
2180|chp|hut       NDTRVAILQAM--LELGADEQP-----------VSFTAIFEQVDMADSANFSYHLEQLTG
105|hp|hhi         SETRLDILEAL--WR--AEDRP-----------VRFSELFDAVELADSGQFNYHLQELTG
12826|hp|hma       SETRLDILEAL--WR--ADDRP-----------VRFSELFDAVELADSGQFNYHLQELTG
7540|hp|hbo        NETRLAILEAL--WR--SADRP-----------VAFSDLRRRVGMRDSAQFNYHLGKLTG
725|hp|nrc1        NETRIDILQAL--WR--APERP-----------VSFSALRKRVGMRDSAQFNYHLSKLTD
                       :                .           : :          .:  : *:*  *  

4074|hp|hhi        ----------------------------SNEPV--------------VTVDLERWRDQ--
33350|hp|hbo       ELVRKIDGQYRPRVAALEIVSAIRAGTYDGETVTVDRRQTE-YQCPHCEQSLVITYQDHL
2925|chp|hut       AYVEAVDGEYVPTAGAIALYEAMIANRPTESVP--ADVTVE-ATCPNCDADLHGEYEQEF
32460|hp|hbo       KFVRKSDGEYLLTHAGRQVIGAAVSRTLTDADD-VTVEDVPAGECMFCSGSLMARYENGV
2230|hp|nrc1       LFVEQTEDGYDLRFAGRKLVGSLHSGVYTETGGMVGPQSVD-GTCVLCGSDLEAVYEDQV
33770|hp|hbo       HFVAKEDDGYRLSHAGFEIVAAILAGRYTDHEQ-VGPTAVD-GACNVCGAEATGIYENGR
2514|gene|hla      HFVKRSDDGYEFRYPGRKVVSAIFTGTLTDRAQ-VGFFPVE-GSCYDCDGDLHGWYVDDT
2180|chp|hut       HFLAQREDGYVFRYPGRKVVSSIFTGTLTERAQ-LGFFPVE-GSCYDCEGPLHGWYVDDE
105|hp|hhi         QFVSQGADGYDLRHAGAQVIRAVRAGTFTRTPD-IDPFPVA-GACTRCGGGLLAEYADEQ
12826|hp|hma       QFVSQGADGYDLRYAGTQVIRAVRAGTFTRTPD-IDPFPVT-GACTRCGGGLLAEYADEQ
7540|hp|hbo        QFVAKTDEGYEFRHAGEKVVRAVLSGSFNENPT-VEPFEVP-GECADCGGTLTASYVDEH
725|hp|nrc1        HFVRSTDDGYEFQYAGEKVVRAILAGTFTDRVS-L-SVPIT-GTCFACGETLVGQYADER
                                                                            :  

4074|hp|hhi        ---SCPACDVEHG------------------------EIHHRLCDYEE--CPACGELLL-
33350|hp|hbo       LYVGCPDHGAAIA--YPVPPRAVTGRTIEDVLDLSLRKHACDVRLLQDGVCPHCWSTAGL
2925|chp|hut       LTVECPACDIFWGATYRFPKHGVAVREGVDVYEALYDRMMYHVGLARTGQCPSCAGITGV
32460|hp|hbo       ATVDCAACDDLIT-RMPIPPNTVANIDAEALPEVFSKHLLTVTHQLSRGFCKLCYGQVDA
2230|hp|nrc1       GKVDCTDCEVTII-QTGVPPAFVDGRE-DDLAAAIDGYVRTTSRSLLDGFCPTCSGPTAG
33770|hp|hbo       LEVTCANDHPLLS--WAIPPNAATDATVNDLATLATSLIRHAIDLALQGVCSECYGTMTT
2514|gene|hla      LTVGCADCGTIQV-SYPFPSGGLDDRTTDELLQAFHHYVRHHYCLAADGVCPECTGAVET
2180|chp|hut       LTIGCTDCGTIQV-SYPFPAGGLDDRSTEDVLEAFQHYVRHHYCLAADGVCPECTGSIES
105|hp|hhi         FAIDCEDCGKAHG-EYPFPPGGLVDRTPAEVATAFAERVRHLHCLAADGVCPDCAGRMRT
12826|hp|hma       FAIDCEDCGKAHG-EYPFPPGGLVDRTPAEVATAFAERVRHLHCLAADGVCPDCAGRMGT
7540|hp|hbo        LSVGCRECGRLHA-HAPFPPGGLTDRSDEEVAHAFDQRVRHLHCLAADGVCPECGGRMAT
725|hp|nrc1        LSVECAACATTYA-RYAFPPGGLRNRSDAEVAAAFDQRIRHLHCLAADGVCPECGGRMTT
                       *                                             *  *      

4074|hp|hhi        ------------------------------------------LC----------------
33350|hp|hbo       SFPRESVPDSYLLDDVPYATA---------------------ACDTCWLSYPIPVAHTVL
2925|chp|hut       TLPWDRLDGESTPTVEM-------------------------TCGTCSWLATVDVISALQ
32460|hp|hbo       SLTVFSSVESVTHCSPLDVQF---------------------ECRECGDQTHLNAGGVVM
2230|hp|nrc1       HLA----ENDYGPQAVV-------------------------NCERCGISFSGLAAWVAV
33770|hp|hbo       RITSGKRDEDGSNRRDEGSEDGSGGDGDSDTSDKRTTPVFRGDCEMCGASLVGPAWFALT
2514|gene|hla      TLVR---DPDEE-DLDVAVEH---------------------VCQRCNYRLRSTVGVTLL
2180|chp|hut       DLV----TDPEEDALDVAVEH---------------------VCQRCGYRLESTVGITML
105|hp|hhi         DISR---DGDCCLDVSVRAEF---------------------VCEQCRHELCSPVGLTLL
12826|hp|hma       EISR---DGDCCLDVSVRAEF---------------------VCERCRHELCSPVGLTLL
7540|hp|hbo        TLS----QDAGPLDVAACSVH---------------------RCEQCDHRIRSPVGLSLL
725|hp|nrc1        TLTP---DDDSRLDLNVRVDH---------------------TCQQCQHTLSSPVGLSLL
                                                              *                

4074|hp|hhi        --------------------------SCVVE--IEVVASSGVKGRLKQSLARLV------
33350|hp|hbo       GHPAVETLYADHGFGLADAQIGPHD-LARVADVVCCTSDSP-AVRLTIDLGDRPLVFELD
2925|chp|hut       FEPRVTSALVEIGVPREETSSLRATERVLPAVTGRVESREPFSATVTVPHEGAIAEISVG
32460|hp|hbo       DHPAVTSLLFDAGIDLRRVYIWELT-SLLDPE-VTTVSEDPLQLHLTIHLNGETLDLTLD
2230|hp|nrc1       DHPAVLSFYDDHDRSVRDTALWHLD-WLADAEWVDGAAGD--RATVEVRLDDERLRVTVT
33770|hp|hbo       VHPTVDAFYHDHGVAVRDALLWELG-HVEYDT-KPVRDDDS--VVISIVLDDERLDVTLS
2514|gene|hla      DHAETLLFFSERGVDLNTEPFWGFD-WCVSDERTTIVAEDPLRVQLSLPCGGDELRVVVD
2180|chp|hut       DVADVLVFFSKRGVDLNAEPFWHFD-WCVSDKRTEIVDDEPLRVRLTLPCAGDELRVLLD
105|hp|hhi         DDSRVTAFYDDHGVDLSSRPYWTLP-WCVDDQYTTVEGTDPWRLAVRIPLAEAELTAYLD
12826|hp|hma       DNSRVAAFYDDHGVDLSSRPYWTLP-WCVDDQYTSVEATDPWRLAVQIPLAEAELTAYLD
7540|hp|hbo        DQSDVVGFHTSHTVDLRSRPHWTFE-WCVGDR-TTVLDDDPWRVRVAIPLNEEELRVTLD
725|hp|nrc1        DDATVVAFHADHGIDVTSTPHWTLG-WCVTDA-TTAYDPDRDRATVTIRLDDESLTVTLD
                                                          .     :              

4074|hp|hhi        ----------------
33350|hp|hbo       ESCAVLDYWRR-----
2925|chp|hut       EGLEVRAVETTTD---
32460|hp|hbo       DTATVIAYDRR-----
2230|hp|nrc1       DDLAVTAVDRAQTD--
33770|hp|hbo       ESGHVLETDVGPA---
2514|gene|hla      GSVDVVETTLVE----
2180|chp|hut       ETVSVIDTAVVERLPE
105|hp|hhi         RDLQPVEFERQACGH-
12826|hp|hma       GDLQPVEFERQDCGH-
7540|hp|hbo        SELAVVAVERRRLD--
725|hp|nrc1        GSLSVVDTTRA-----