HOG Organism Gene ID Name Annotation
aHOG1152 hhi 1535 HAH_1535 ferrichrome-binding protein
aHOG1152 hhi 5358 HAH_5358 ferrichrome-binding protein
aHOG1152 hhi 5280 HAH_5280 ferrichrome-binding protein
aHOG1152 hhi 5133 HAH_5133 putative iron transport protein
aHOG1152 hhi 5132 HAH_5132 ABC-type transport system periplasmic substrate-binding protein
aHOG1152 hhi 5131 HAH_5131 ferrichrome-binding protein
aHOG1152 hhi 5038 HAH_5038 ferrichrome-binding protein
aHOG1152 hhi 5009 HAH_5009 putative ABC-type transport system substrate-binding protein ( substrate iron/cobalamin)
aHOG1152 hhi 4296 HAH_4296 ferrichrome-binding protein
aHOG1152 hhi 4213 HAH_4213 ferrichrome-binding protein
aHOG1152 hbo HBOR03350 Hbor_03350 ferrichrome-binding protein
aHOG1152 hbo HBOR07800 Hbor_07800 ferrichrome-binding protein
aHOG1152 hbo HBOR15980 Hbor_15980 ferrichrome-binding protein
aHOG1152 hbo HBOR19640 Hbor_19640 ferrichrome-binding protein
aHOG1152 hbo HBOR25280 Hbor_25280 ferrichrome-binding protein
aHOG1152 hbo HBOR31020 Hbor_31020 ferrichrome-binding protein
aHOG1152 hbo HBOR32830 Hbor_32830 ferrichrome-binding protein
aHOG1152 hbo HBOR33120 Hbor_33120 ferrichrome-binding protein
aHOG1152 hbo HBOR33590 Hbor_33590 ferrichrome-binding protein
aHOG1152 hbo HBOR34440 Hbor_34440 ferrichrome-binding protein
aHOG1152 hbo HBOR35640 Hbor_35640 ABC-type Fe3+-hydroxamate transport system, periplasmic component
aHOG1152 hbo HBOR35980 Hbor_35980 ABC-type Fe3+-hydroxamate transport system, periplasmic component
aHOG1152 hbo HBOR36610 Hbor_36610 nucleotide sugar dehydrogenase( EC:1.1.1.- )
aHOG1152 hbo HBOR37770 Hbor_37770 hypothetical protein
aHOG1152 hla HLAC0537 Hlac_537 ferrichrome-binding protein
aHOG1152 hmu HMUK0394 Hmuk_0394 ferrichrome-binding protein
aHOG1152 hmu HMUK0396 Hmuk_0396 ferrichrome-binding protein
aHOG1152 hmu HMUK2440 Hmuk_2440 conserved hypothetical protein
aHOG1152 hmu HMUK2711 Hmuk_2711 conserved hypothetical protein
aHOG1152 hmu HMUK3310 Hmuk_3310 conserved hypothetical protein
aHOG1152 hmu HMUK3338 Hmuk_3338 ferrichrome-binding protein
aHOG1152 hmu HMUK3383 Hmuk_3383 ferrichrome-binding protein
aHOG1152 hut HUTA2189 Huta_2189 ABC-type Fe3+-hydroxamate transport system periplasmic component-like
aHOG1152 hut HUTA2190 Huta_2190 ferrichrome-binding protein
aHOG1152 nrc1 VNG1720 vng1720 no entry
aHOG1152 nrc1 VNG2549 vng2549 no entry
aHOG1152 nrc1 VNG2562 vng2562 no entry
aHOG1152 hma Hma_10299 hypothetical protein
aHOG1152 hma Hma_10899 hypothetical protein
aHOG1152 hma Hma_65275 putative-iron binding protein
aHOG1152 hma Hma_7039 putative iron transport protein
aHOG1152 hma Hma_7040 hypothetical protein
aHOG1152 hma Hma_7041 hypothetical protein
aHOG1152 hma Hma_7190 ferrichrome-binding protein
aHOG1152 hma Hma_7277 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


36610|gene|hbo      -------MK-------ICVHGIGYIGLATAALFANNGHDVVG---YDPNEKLVEELRAGN
37770|hp|hbo        -----------------MPGRISRHQSAGDL--GGDYAGC--------------------
5038|gene|hhi       -MAKTDPDE-------TWSTRRECVKYGTTLLTAGSLAGCSG---------ASSEAT---
35640|gene|hbo      ----MRMLR-------ETSTRRDVLKGGSALIGSGFLAGCTS---------SGQSTPPSD
4213|gene|hhi       -MQNKDILD-------CCQRRREILKAGCSIVGGGIVAGCLG---------TTDDSSSDD
33120|gene|hbo      -MAAETDVH-------EIPTRREMIQGGSTILGGGLLAGCTS---------DGGDPTPAD
5009|gene|hhi       ----------------------MVASLAGCSSGSSDDGGTTG---------DGAASAQTD
7800|gene|hbo       -----------------MPSRRRVLASGASLLAVG-VAGCSS---------STTETSPAD
2562|hp|nrc1        ------------------MARRRQILAGGASLIAASLAGCTS-----------SQSPTDD
537|gene|hla        -MGKHADRS--------APTRRTVIRFGGAVAGAGSLAGCLG---------GGSGGSGSD
19640|gene|hbo      -MSGNDNGP--------ESTRRDYVKYGGTVLTGGLLAGCMG---------DTDASSTPT
5133|gene|hhi       ------------------------------------------------------------
7039|gene|hma       -MSRYDMNR-------EGPTRRDYMKYSGAVVGGSLLAGCAG---------QSGSEAAPT
34440|gene|hbo      -MAKDANET-------DAPTRREYVKY-GAVLTGGLLSGCAG---------NAPTDSEST
2190|gene|hut       -MGDDSSSTSGESVAPETPTRREAIKYGGAALVGGLLAGCSS---------SATDDEGDP
5280|gene|hhi       -MADDTTDI-------ESPTRREYVKYGGTVLSAGLLAGCTG---------DAERGTGSA
7277|hp|hma         -MADDTTDT-------ETPTRREYVKYGGTVLSAGLLAGCTS---------DAEQGVGTT
31020|gene|hbo      MEQDDVERPPESRRGSGGPTRREYVKYGSSVLCGGLLAGCAG---------ENGSQSVPA
5358|gene|hhi       --MDETDGT-------GSLTRRDYLSGGGLLLGTSIVAGCSS---------NGGEPPSTA
7190|gene|hma       --MDKADDS-------NGLTRRDYLSGGSVLLGTSIVAGCSG---------DGGESPSTA
25280|gene|hbo      -------MA-------KTPTRRMYLKRTGALIGAGVVAGCSG---------DGDSSAATT
1720|hp|nrc1        -MA-------------GEATRRRCL--GHVAAGAALLAGCTS---------HSDTSTSTE
32830|gene|hbo      -MTGDSSQH-------EALTRRDYMKYGGAVVGGGLLAGCSS---------QSSTESAPT
2549|chp|nrc1       ------------------MQRRAFLKAGSAATLAGLLAGCSS---------PDSDATSTA
65275|gene|hma      -------------------------------MASGLLAGCSS----------GSSESEST
10299|hp|hma        -MSSNSNDQ-------SELTRREYVTCGGTVLAGGLLSGCTG---------SSGSDPSDS
5131|gene|hhi       MSGPDGATF-------ERPTRREVVKGGGTLALGGLLAGCLG---------NSSQESSEA
7041|hp|hma         MTDPDRAAC-------EWPTRRDIVRSSGALAFGGFLAGCSG---------ESGQESSVT
1535|gene|hhi       ------------------MNRREYIVATGVGL-AGAVAGCSG---------QSEAGSGGD
10899|hp|hma        ------------------MNRREYIVAAGVGL-AGTVAGCSG---------QSEAGSGSD
33590|gene|hbo      MERDSNFGQ----------SRRRFLRTGAGIAVSGALAGCAG--------QDSSSPTTSE
15980|gene|hbo      -MANDGIKR-------NGATRRDYLKYGGAILGSGIVAGCTG---------ESDSEATET
2189|gene|hut       -MSDDAGSR-------TTPTRREYLKYGLAVGTGGLLAGCSGGERTE-TAQPADQETATA
35980|gene|hbo      -MSEDSGGH-------KAPTRRDYMKYGGAVIGSSALAGCAG--------LFAPDDTGGT
4296|gene|hhi       -MDGNNGSQ-------ETPTRRDVLKYGGVATGSGLLAGCAG---------VFGSDSQST
3350|gene|hbo       -MAKNDTEC-------GKSTRREWITYGGAVLAGGLLAGCTG---------ESEGNTSPT
5132|gene|hhi       MTDPGRPAL-------EQPTRRDYIKGAGLIAGGSLLAGCSS---------NSATDSTAT
7040|hp|hma         ------------------------------------------------------------
                                                                                

36610|gene|hbo      PRTTEDDLREYVLDALDEDFEPSNEVVEADCHIICVPTPYEEESKRADLSYVEMAGQTVA
37770|hp|hbo        ----------------------------------------------IE----SVHKTELP
5038|gene|hhi       ------------------ESGETKAGPD---------RSFSGTMAPVG----ELRLESNP
35640|gene|hbo      STSSDSSR----------GTSTDTATTE---------QSYSVSLDPVG----TIPFEQPP
4213|gene|hhi       TTPTSPS-----------GEESMTEADDP--------TPYEVTVKPAG----THTFDSVP
33120|gene|hbo      AA----------------DTATNSPTDTP--------TSYEVAIEPAG----RHTFEEVP
5009|gene|hhi       QAEATA------------DTEQSTPENS---------TPYTVEIEPHG----EFTFEEVP
7800|gene|hbo       DESTQTGNTAQS------ETESKATTED---------DSYTVTVEPNP----PHTFESVP
2562|hp|nrc1        GSTT--------------QTDAGS-------------DSYTVTVEPNP----PHTFESVP
537|gene|hla        GDSDGADGSDDA------ETEGADGSEDEETDDGGSAGSYTVEMAPVG----EVTLDAVP
19640|gene|hbo      TNASETTTESTA------TGSTEAESDD---------SGYSATISPVG----EVEFESVP
5133|gene|hhi       ----------------------------------------------MG----TVEFETVP
7039|gene|hma       QTGTG-------------DQSTAEPTTAE--------DRYAVTMSPMG----TVEFESVP
34440|gene|hbo      TTETNT------------ETANQSGSSGDSETETDATNPYTVSMAPMG----EVEFERVP
2190|gene|hut       DSETATTSVRTETATPSDPTETATTSEDTETTTETESDTYSASIAPMG----RVSLEEPP
5280|gene|hhi       PTEA--------------VTETDTTTAD---------GSYSVSMSPMG----AVTFDSPP
7277|hp|hma         RTES--------------EAETDTPTGN---------GSYAVSMSPTG----EVTFDSPP
31020|gene|hbo      GT----------------PSETPTAKD----------DSYSVTMEPAG----TVEFDHVP
5358|gene|hhi       TASDK-------------ETGTSTPSDD---------GSYVASLSPVG----EVEFDSVP
7190|gene|hma       TSRDS-------------GTDTSTPSDN---------GPYTASLSPVG----EVEFDSVP
25280|gene|hbo      ESTEA-------------HPETTTETETTPEESETAASPYTVSMKPMG----EVTLDAVP
1720|hp|nrc1        PP-----------------------------------ASHHAAVAPVG----DLTLTGVP
32830|gene|hbo      DTSGAE------------PTASATGTPA---------ESYEACIEPVG----CQTFEEVP
2549|chp|nrc1       ADSAT-------------ATADETTAGS---------GSYSVSMEPVG----DVEFDAVP
65275|gene|hma      PESA---------------------------------DSYTVSMEPMG----PVTFDGPP
10299|hp|hma        ETAT--------------ETATTTATESKPAETAATDKPYRVTVEPVG----EVSFETVP
5131|gene|hhi       GTGDRATDTE--------PSATGPATSD---------GTYSVTMEPVG----TVEFETVP
7041|hp|hma         EGSDMTTATRAG------GTETDPATSD---------GAYSVTMEPVG----TVEFETVP
1535|gene|hhi       GATDDATDS---------GTTTATATTEPTE------SGYSVAMEPVG----EVTFEAVP
10899|hp|hma        GGADEST-----------ASGTTAAESTPTATTEATGSSYAVSMEPVG----EVTFESVP
33590|gene|hbo      PDTEGTAETSTAEAT---ETSRETAETD---------DSYTVSMEPVG----TVEFDEVP
15980|gene|hbo      STSTETATAT--------ETETETATEA------AADGSYSVTMEPVG----TVEFDSVP
2189|gene|hut       TPTETATETET-------TTETEAETTTETATETTADTPYTVEMAPVG----EVSFEEVP
35980|gene|hbo      ETSTVTAT----------GTESETATED---------VSYSVTMAPMG----EVTFDSIP
4296|gene|hhi       PANNTT------------EKSTETATES---------TNYSVTMEPIG----EVEFDSTP
3350|gene|hbo       A-----------------DTETETAEES---------GSYTVSMEPVG----ELTFESVP
5132|gene|hhi       EPTE--------------TTETPTATET---------ESYTVNMEPVG----DVTFQTVP
7040|hp|hma         -------------------------------------------MEPAG----DVTFQTVP
                                                                               .

36610|gene|hbo      EHLREGDMVILESTVPPGTTEEVLAPILAAAELTPGRDFSLSHCPETVLPG-NI-AHELV
37770|hp|hbo        QSIIELSAEYDR---CVGTRDEFLWK----WI--HGLFDAFTL---PCVPSSVL-DEVTT
5038|gene|hhi       ETIVGGWGFEEDILTALGEADKLIAA----EG--NQFWFTGFY---DQLPGVDVPDPESL
35640|gene|hbo      ETVVSGWGFVGDVLMALGQADRIVGM----SR--PGFWFQGFY---ELLPGVSMRDTTAI
4213|gene|hhi       ETYASFPGAWMDIAMALGIKPSAMMS--------LEEEQLKYY---KALPDVAV-DLGSV
33120|gene|hbo      ETYASIPGAWMDIAMGFGIQPKAVAA--------FDRLPLKYY---DALPGVDF-DADAV
5009|gene|hhi       ESYSVIPSVYLDIGMALGIQPTAATD--------MARAPRKFY---DILPDVTF-NEDDI
7800|gene|hbo       KTYAVIPSVWMDIGMALGKQPSATAS--------LDRAPLKYY---EHLPDVSF-DPDSV
2562|hp|nrc1        ETYAAIPSVWMDIGMALGIQPSATAS--------LGRAPLKFY---DALPDVAF-HKAEI
537|gene|hla        EDVMVYSLLYADMAVAFGHGDAVNSLGFDADA--GGNTLDAYY---AELGGVAF-DREGV
19640|gene|hbo      ENVFTILSHHTDMALALGYGDNINAM-HAPGY--IQSLWSKFT---HHLDGVSV-DWDGL
5133|gene|hhi       QSVFTILGHHVDMLVALGRGDAINAM-HAPEY--HQSLYQKFL---HRLEGVSI-DWDDL
7039|gene|hma       QSVFTILGHHVDMLVALGRGGAINAM-HAPEY--HQSLYQKFL---HRLEGVSI-DWEGL
34440|gene|hbo      ESIFTRLTHLAGMAFALGRGDDVNAM-HAPGY--YDALWNQFT---PRLPGVTL-DWKGL
2190|gene|hut       ETVFTRLTHHADMAFALGRGDTITAM-HAPAY--YDRLWNQFI---ERLPGVTL-DWEGL
5280|gene|hhi       ETVFTRLTHHADMALALGRGDTVTAM-HAPDY--YSGLWNQFV---ERLPGVSL-DWTGL
7277|hp|hma         ETVFTRLTHHADMAFALGHGDTVTAM-HAPEY--YSGLWNQFV---ERLPGVSL-DWTGL
31020|gene|hbo      ENVYTGLPNTADMAVAAGHGDAINSI-YYPEY--HGTILNHFY---DRLDGVSL-TWEKL
5358|gene|hhi       EKVFTMYNQYADMLVALNHGDAVNSM-FVPEM--AGPSMNHYY---ERLSGVSF-EWEDL
7190|gene|hma       ENVFTMYNQYADMLVALNHGDAVNSM-FVPDM--AGPSMNHYY---ERLSGVSF-EWEDL
25280|gene|hbo      ENVFTVYPQYADMAVALGHGDALNSV-YVPEM--SGTTMNQYY---HHLDGVSF-EWQNL
1720|hp|nrc1        DRAFVVFPQYADMAVALGHGDAVNAI-YVPEM--SGPTMNAYY---DRLDGVDF-DYGGL
32830|gene|hbo      ETYMVNNGEWADMAFALGQRDGFLTS----AYMIPGFLFEPFG---LDVPPLS--ETESL
2549|chp|nrc1       DTVAVYESGYADMVVALGHGDALTAV----GN--SDRFHTDAY---DALDGVSV-DTSGL
65275|gene|hma      EDWVALLPSYADMGMALDAGQTL-GI----QL--PYRYATGFY---EELPGVEY-DPDAV
10299|hp|hma        QTWVAENASWADMGVALGLTKPSAVV-----L--SGEYRTWHY---EDVPGLSP-SKEDM
5131|gene|hhi       ETIAPFTADYIDMLVALGHGDAVQSI----WY--RGRYKTLHY---EELDGVSI-DLNAL
7041|hp|hma         ETIAPFTADYIDMLVALGHGDAVQSI----WY--RGRYKTLHY---EELDGVSI-DLDGL
1535|gene|hhi       EGWVANNGSWADMGIALGL-DAPEGV----WL--PSRYHTQYY---DEIPGVSV-DGSSI
10899|hp|hma        EVWVANNGSWADMGIALGL-DAPEGV----WL--PSRYHTQYY---DEIPGVSV-DGSSV
33590|gene|hbo      ESWFSYTADYADMGVALGQGDGLSAI----GV--RARFGTHLY---EELSGVSV-DKADL
15980|gene|hbo      ETWATYCQGYADMGIALGQADGLLSV----GY--KPRLHTHWY---EELDGVSV-DKESL
2189|gene|hut       ETFTPYSGDYADMAVALGKGDGIQGI----GF--ADRYYSYVY---DELPGVSV-DREQI
35980|gene|hbo      EQWVPYGGDYADMGVALGHADSMIGI----GQ--PGEYYTYVY---EELPGVSV-DKDRI
4296|gene|hhi       DQWIAYDGSYADMGVALGQADGMTGI----GG--ADRYYTHLY---NEIPGVEI-DTEPI
3350|gene|hbo       DRWVAYDGGYADMGVALGKTDGMTGI----GG--SDRYYTDVY---DELPGVSV-ERETL
5132|gene|hhi       ERWLPYGGTYADMGVALGQADGLTGI----GG--ADRYYTYVY---DELPGVSV-DQETI
7040|hp|hma         ERWLPYGGAYADMGVALGQADGLTGI----GG--GDRYYTYVY---DELPGVSV-DQETI
                    .                .                              :           

36610|gene|hbo      H--NDRIIG--GIDDE---STDKTIALYDPLVEGTIHRAPDATTAEFVKLSQNAYRDVNI
37770|hp|hbo        T--KTVFTMYITALDDLTDHLGDEATFEQARRL--PHAP-ESVRYDAPGVDTD----ILR
5038|gene|hhi       ELVRTDDW---SLRTEMLYELDPDLFATDPNRF--ISYY-GADEGDISEITDS----IGP
35640|gene|hbo      P--NTVSKGY-SLNEELLYELDPDLLATDPNRF--IAWY-GSDTATVESLVDD----IAP
4213|gene|hhi       E--TLLDSNDSEFDKEVFYEVDADVHLMDPRIL--KRYS-GWNDDDLEEIEHN----VGP
33120|gene|hbo      R--TLGESAESKYDKEVFYDVDADVHLMDSRML--KKYS-GWDDEDLEEIESN----VGP
5009|gene|hhi       M--ALAAGSESGYDKENFYAAGPAVNLIDPRGL--RRFT-DWADSDIQEIEEA----TGP
7800|gene|hbo       T--KLASSAEEGFDKENFYAADVDVHLIDPRSL--KFYA-NWSDADIEEISNA----TGP
2562|hp|nrc1        E--QLASDSESGYDKENFYAADCDVHLIDPRML--KFYA-NWTDDDIAAIESS----AGP
537|gene|hla        RQLNTGSGGGISVDRELLYELDSDLHLADPCLF--VSFD-GWDQGDMAEVRDN----VAP
19640|gene|hbo      Y--SS--W---PPTKEKLYELDSDVHLADPARV--ATAE-GWDESDIEEIKEN----VAP
5133|gene|hhi       Y--SS--W---PPSKEKLYELDSDVHIADPAKV--ATAE-GWDDSSLEEIGSN----VGP
7039|gene|hma       Y--SS--W---PPSKEKLYELDSDVHVADPAKI--ATAE-GWDNNSLQEIESN----VAP
34440|gene|hbo      Y--SS--W---EPSKEKLYELDSDVHLADPAGV--SALD-SWNADDVEAIGEN----IAP
2190|gene|hut       Y--SS--W---QPTKEKLYELDSDIHLADPAWI--TVQD-NWDPADIEEIESG----VSP
5280|gene|hhi       Y--SS--W---KPSKEKLYELDSDIHLADPAWI--AKQD-NWDREDFEEIATN----VSP
7277|hp|hma         Y--SS--W---KPSKEKLYELDSDIHLADPAWI--AKQD-SWGREDFEEIATN----VSP
31020|gene|hbo      T--DS--W---NLGKEGFYELDSDVHLTDPAYA--STLE-QLDEADVAEISDK----IGP
5358|gene|hhi       P--NP--Y-D-NFSKEFFYSLGSDVHFLDPAWA--ITQE-NWDMGDIEEIVDN----VGP
7190|gene|hma       P--NP--Y-D-NFSKEFFYSLGSDVHFLDPAWA--ITQE-NWDMSDIEEIIDN----IGP
25280|gene|hbo      T--DP--LSD-GLHKEQLLELDSDVHLADPAWV--STQD-TWDAGDVAEIESQ----VAP
1720|hp|nrc1        P--DP--LTD-GFTPEECYALDSDVHFVDPAYV--STQD-AWDARDIETIASD----VGP
32830|gene|hbo      S--QT------NWDKEIFYEQDPDVILMDPNYMHKTGWDKSWDKSDTNEISEN----VAP
2549|chp|nrc1       V--DL--VDA-GVTRETLLDLDPDVYLMDPNWL--TSTF-ELDRGDIDFLTQR----SAP
65275|gene|hma      T--TL--YQD-GVDKELFYEIDADVHFMEPNQL--RNWY-DWDDRDIREVKEN----IGP
10299|hp|hma        V--SL--WQD-GISKELLLEIDAGVHFIDPNYM--VNLIPNWDRSDVEEMHER----VGP
5131|gene|hhi       T--QL--WSD-GVSKEAFYEMDADLHLIDPHAL--THWLKAWEQSDLTEVREN----VAP
7041|hp|hma         T--QL--WND-GVSKEPFYEMDADLHLIDPNAL--IDWLGAWDQSDLTEIREN----VAP
1535|gene|hhi       Q--KL--WGDSGVGKEQFYEIDADIHVMDPNFL--QSRG-SWEQSDIDEIETQ----VGP
10899|hp|hma        Q--KL--WGDSGVGKEQFYEIDADIHVMDPNFL--QSRG-SWEQSDIDEIESQ----TAP
33590|gene|hbo      T--QL--WQD-GTGKEVFYELDADVHLIDPNFM--VNRL-QWSQEDIDEIDSN----VAP
15980|gene|hbo      Q--EL--YQG-GIDKELFYTMDADIHVIDPNWI--INNFKGWEQADIDEITEG----VAP
2189|gene|hut       E--ED---PE-VRTKEQFYALDSDVFLYDPQML--INWF-DWGPADVSEIREN----VAP
35980|gene|hbo      E--KNDLVEA-GMSKELFYEMDSDVHIIDTGML--RNWF-DWRDEDIAEISEQ----VGP
4296|gene|hhi       E--S---YPE-VRTKEEFYELDNDVHLYDPQML--INWF-DWDESDIEEITTN----VAP
3350|gene|hbo       E--ANDLGDA-DMSKEVFYELDNDVHLMDPQML--VNWF-GWSETDVDEIATN----VGP
5132|gene|hhi       D--AN---PE-VRTKEEFYELDSDVHLYDPGML--INWF-DWSQSDVDEIAEN----VAP
7040|hp|hma         D--AN---PE-VRTKEEFYELDSDVHLYDPQML--VNWF-DWSQSDIDEIAEN----VAP
                                   :     .      :.                   :          

36610|gene|hbo      AFANELARVA----ADYGIS-SRDAIDLANVHPRVDILNPGPGVGGHCLPIDPWFL-GQF
37770|hp|hbo        FAETLWNRVT----DRL--TAAPRYEEHLDVF--IFDVRQALNAMEYARVLNDNQEIANL
5038|gene|hhi       FFGNASRRKRGDDWPTWPSGESYPYYDIPEFVSRYGALLGKPETAAAINTLYEQAL-QEM
35640|gene|hbo      FFGNESRSKRPSGWPNWPTGEDYDYYAIPEFVERYGQVFQEQKRATAMVDLYETTL-DDI
4213|gene|hhi       ILGSMIR-------FPY---ERDPYYTLYEAVEKAAKIFQRQERYDAWVDLKDEVF-AEI
33120|gene|hbo      ILGSLIR-------FPF--GGRDPYYTLYEAFEKAAQIFQRQAQYEAWVTLKESFY-ADI
5009|gene|hhi       FVASSI-RFGPEHPFGY--E-QETYHELYDVFEKMAAVFQCQARYRAWESLHDEFM-ANI
7800|gene|hbo       FLGSTIRFAS----SSI--NEHEPYYDLYGAFEKAGQIFQRQARFRAWQSLYDEFI-SNI
2562|hp|nrc1        FMGSSIRFAS----SSA--VGDGPFYDLYEAFEKAAEIFQRRARFEAWQSIKADLM-DTI
537|gene|hla        WFGNVYSRRNSQPPEPC--RDDYEYYGLWEITERVAGVFQESERFEALAAVHDDLI-ETV
19640|gene|hbo      WFGNTFSDAHQQPPAAW--QDGYEYYTLWETFGRVAQVFQEEERYKALADVHNSLL-TTI
5133|gene|hhi       WFGNTLSGTHQKPPSGW--ADAYEYYTLWEIFGKIAQVFRESDRYEALTSVRESML-QTI
7039|gene|hma       WFGNTLSGTQQEPPSGW--GDAYKYYTLWEIFGKIAQVFREGARYEALASVRESML-QTI
34440|gene|hbo      WFGNYYSDRHATPPEAW--TDDYQYYDLWEMFERVAQVFREEARYEALAEIHRRLV-ETV
2190|gene|hut       WFGNSLSDTHQEPPDAY--ADGYEYYTLWEQFERVAQLFGEQARYEELAAIHADLL-GTI
5280|gene|hhi       WFGNSLSDRHAEPPSGW--G-DYEYYTLWEQFELVAEAFQEQARYEALAAVHDEMR-STI
7277|hp|hma         WFGNSLSDRHAEPPSGW--A-NYEYYTLWEQFELVAEAFQEQARYEALAAIHDEMR-STI
31020|gene|hbo      WFGNYYSDKRRDPPQSW--ADEYRYYSLWEIFERVAQVFRAGSRADALRDVHESMR-STI
5358|gene|hhi       FFGNFYSGTHGDPQEPY--SENYHYYTLWELFGRVATVFQERKRYEQLRAVHQELI-ETI
7190|gene|hma       FFGNFYSGTHSDPQGPY--SGDYQYYTLWELFSRVATVFQERRRYEQLRAVYDELI-NTI
25280|gene|hbo      WFGNFYSGTHAEAPDGY---DDYGYYTLWELFGHVADVFQERTRYEALNEVHQNLV-STI
1720|hp|nrc1        WFGNFYSGTRADPPQGY--RDGYDYYTLWELFGRVADVFQERARFEALRRVHETLV-ATI
32830|gene|hbo      FFGNNILRRR-----DW--H-DYKLYSMYEALERLAELFQERERYEALAEVHASVQ-DEI
2549|chp|nrc1       FLGNTIFRRT----DAW--H-DYDYYSLYEAFETVAELFDETDRFDAFQSFHDSAL-DRL
65275|gene|hma      FFGNFIRRRS----DDW--H-DYPYYSLYGAFEKIAQVFDREQRYQQFASFHEEFL-TNL
10299|hp|hma        FCGNTSFST-----YSW--HEDYPYYSLYEATEKVAAVFQRQDRFRALSSLHEGFL-DRL
5131|gene|hhi       FIGNLVFRRT----DDW--H-NYRYYSLYEAFEKVAEMVQEQARFEAIRSIHAELA-ETV
7041|hp|hma         FLGNLIFRQT----DDW--H-DYRYYSLYEAFEKVAEMVQERTRFEAIRSIHDELV-ETV
1535|gene|hhi       FFGNSIFSTG----YEW--H-DYTYYTLYEAFEKLSQAFQRTDRFEAFRTLHEEFQ-TSL
10899|hp|hma        FFGNSIFSTG----YEW--H-DYTYYTLYEAFEKLSQAFQRTDRFEAFQSLHEEFQ-TSL
33590|gene|hbo      FFGNTIFTRA----YDW--H-DYADYTLYEAFEKVADVFQAQDRFEAFETYHNEVI-ADV
15980|gene|hbo      FIGNLIFRHT----DTW--HEDYQYYTMYEAFEKVAEIFQEQERYEAFKSLHDEYVRGRV
2189|gene|hut       LFANLIFRRE----DAW--H-DYRYYTLYQAFEKLAELFQREERFQAFETLHEEFL-ADV
35980|gene|hbo      FLGNMIFRRS----DSW--H-DYRFYTLYEAFEKVAELFQERDRYEAFKQYHDEFI-TEI
4296|gene|hhi       FVGNLIFRRS----DDW--H-DYRYYTLYEAFEKVAQVFQEQERYAAFKELHDEFI-ADI
3350|gene|hbo       FFGNLIFRRE----DKW--H-DYRYYTLYEAFEKVAQLFQEEERFNAFQSLHDEFI-AEI
5132|gene|hhi       FIGNLIFRRS----DEW--H-DYRYYTLYQAFEKVAEVFQEQARYEAFKQLHDDYI-ADL
7040|hp|hma         FIGNLIFRRS----DNW--H-DYRYYTLYQAFEKVAEVFQEQARYEAFKQLHDDYI-ADL
                       .                                                       .

36610|gene|hbo      SDSLNLIE----SARRVNDGMID-----F----VIELLEDELSSLENADIAVLGVAYKGN
37770|hp|hbo        AESRH----HGPFNMVMFPYAGID--LMW---------TPSFDRQELGQL----------
5038|gene|hhi       RSRVPPES-DRPSVGLLNAQINPDNEGFFRAYNPRTEIDKAYGKKQYRDLGVVDAFEGEY
35640|gene|hbo      TSRLPPLD-ERPTVGVLSAFTNPENSGHFGVSNPIPALDATHELKHYGDLGVVDAFAEQY
4213|gene|hhi       QSRLPD---DKPTVGAFIIDFDIEGKSLR----AAEIDAFRNDTRTFRKLGVNSAFKGDT
33120|gene|hbo      ESRVPVSGGDEPTVAAFNFGFDPESGKFF----AANIDAPRNDTRSFRMLGVNNAFQGEE
5009|gene|hhi       RSDLPPED-ERPSVIAVWRGVDPTSGQFY----LSDIHKYHNQTKPLSRLGLRDGYDAEI
7800|gene|hbo       ESKLPPKS-ERPTVAAIWRGVNPDSGTFR----ISPIHAKQNNTRTYRVLGLKDAFEGQI
2562|hp|nrc1        SDGLPPES-DRPTVAAIWRGVRPDTGQFR----IAPLDPDQNNTLTYRRLGMQDAFAGAV
537|gene|hla        QADLPPTE-ERPTVGTLLYMDG----TYY----PSLLDDPGFANAHVRPFGVVDAFGADD
19640|gene|hbo      EANLPPES-ERPSAAMVLFSSSDD--SMW----GYKTNAPGYYASHTRPLGATDALTEAV
5133|gene|hhi       RAGLPPEQ-ERPSAAMVLFSTSDE--KIW----GYKMNHPGYYAAHTRPLGATDALADAV
7039|gene|hma       NASLPSES-ERPSAALVLFSTSGE--KIW----GYKMNHPGYYAAHTRPLGATDALADAV
34440|gene|hbo      QEELPPVE-ARPTAVLIGPSDLE---KIY----AYKLDTPGFLTAHTRAAGAVGAFGDDV
2190|gene|hut       EERLPDES-ERPSVVMIAAQDLD---EIY----AYTLDEPGFLTAHTRPFGARDAFDGEV
5280|gene|hhi       DANLPPES-ERPSAVLLAAADLD---EIY----AYTLDNPGFLTAHTRPFGARDAFEGSV
7277|hp|hma         DANLPPES-ERPSAVMLAAADLD---EIY----AYTLDNPGFLTAHTRPFGARDAFEGSV
31020|gene|hbo      ESNLPPTE-ERPTVALTFEGKED---TFW----VYRLNANGFLTAHTRPLDATDAFADVT
5358|gene|hhi       QTELPPEE-DRPTAVRVTLGDGQ----FW----TYHLNRPGFWLADTRPLAANDAFGDET
7190|gene|hma       QTNLPPEE-ERPTAIRVTLGDDQ----FW----TYHLNRPGFWLADTRPLGANDAFGDET
25280|gene|hbo      RSNLPPKE-DRPSVIRATFSESNE--IFW----TYHLNEPGYWLADTRPLGANDAFAEQD
1720|hp|nrc1        ADRLPPKR-DRPTAVRVTYDEGS----FY----TYHLNEPGYWLADTRPLGARDAFADAD
32830|gene|hbo      QSRLPPAD-ERPEIALINSASNPNEGTFY----PMRTQDEGVELKPYRDLDIRSAFTADH
2549|chp|nrc1       ETALPSEG---PRGALVWGGSNEPT-SFS----PYLLSGAGTNKKPFHDLNVRDAIADSG
65275|gene|hma      QERLPETT---PEAALLYPADKTPE-TFY----LYQLYDGGVGKKHWRDLRLRDAFEGTD
10299|hp|hma        QERLPPED-QRPEIALLSPGSTEPE-TFY----PYRLGDR-TAYKHWRDLGVSDALAGSE
5131|gene|hhi       QARLPAPE-ERPNAALMFAGEEPE--AFT----PYRISGNGANKEHFQTLGIADAFSDTG
7041|hp|hma         QARLPAPT-DRPNAALMFAGEEPE--AFT----PYRISGNGANKEHFQTLGISDAFADTG
1535|gene|hhi       EDLVPDSESERPEVAIVWAGSDEPT-SFS----PYLIED-GTSFKQWRDLGVRDAFAKTD
10899|hp|hma        EDLVPDSESERPEVAIVWAGSDEPT-SFS----PYLIED-GTSFKQWRDLRVRDAFAKTE
33590|gene|hbo      QSRLP--D-ETPDIAILYPADVPPE-SFY----PY-LVGSGSQSKHWNDLHVGDALANQD
15980|gene|hbo      AEQLPAES-EAASAALIYAAGNEPE-KFS----PYRLNTGGTSIKHLRDLKVKDAFEGTD
2189|gene|hut       QARMPPAS-ERPNVMLTFEGTDEPE-TFS----PYRLNDRGTSKKQWRDLGVADALSGTG
35980|gene|hbo      QSRMPPSG-ERPNVMLTFEGTNEPD-TFS----PYRLTDKGTSKKQWNDLGVADALAGTD
4296|gene|hhi       QSQLPTAD-ERPNVFLTYGVTQEPD-EFT----PYRLNDQGTSKKQWRDLGVSDALGGTD
3350|gene|hbo       QRQLPPAD-ERPNVLLVYEGSDEPE-TFS----PYRLNDRGTSKKQWRDLGVSDALSGTG
5132|gene|hhi       QSQLPPAE-ERPNVLLTFEGTDEPE-SFS----PYRLNDNGTSKKQWRDLGVTDALAGTD
7040|hp|hma         QSQLPPAE-ERPNVLLTYEGTNEPE-SFS----PYRLNDKGTSKKQWRDLGVTDALAGTD
                                                                                

36610|gene|hbo      VDD--ARHSPGLRLVERLTTMEPREVGAA------AADGGQTRACGSVRVHDPHVESDES
37770|hp|hbo        --------RSLLLDLQRMARIGNWI-------------TTWKRELYEDDYTAGVVVEALE
5038|gene|hhi       GGQ-----SGIQVDYEALLDIDPDVLVFH----FGVNYRDWNGEDALRKTVEGMRDSSLG
35640|gene|hbo      GEE--RGHYDLTVGFEGLLAVDPDVLIFDEAVNALGGQTVYGNTKAYERTLELLRTDDIG
4213|gene|hhi       YVR------YKEIGYEKLLDVDPEYIALI-------DNLTTENNESFQQTLQAAKNHETL
33120|gene|hbo      YVP------FKPVGIEKLLDVDPDYIGMI------GY-LSYIDDSQLQKVVETAQDHDVL
5009|gene|hhi       PGG-------GTVGYEELLNHDPDYIAAV------GRLTTATHDEFVTNVVEPFENNPNG
7800|gene|hbo       PDG--------PIGYEKLLDIDPDYIGAV------GGLTSLTHDEFVSTVVEPFENNSNG
2562|hp|nrc1        PDG--------PIGYEELLDVDPDYIGAV------GGLTSQTHAEFVDTVVEPFEANPNG
537|gene|hla        VTY------ETAYDHEQLLEVDPDVILHQ---------YGVESYYDVAAVREELADHPVA
19640|gene|hbo      GDSYENVGDDITLDYETLLEADPDVLLVL---------GPMTEYHNIDDIRAKLEDHDVA
5133|gene|hhi       GDEYGDDGRNITLDSELLLDADPDVLLVL---------GPMTGYHNLDDIRSQLADDEVL
7039|gene|hma       GDGYGDDGRNITLDTELLLEADPDVLLVL---------GPMAGSHNLDDIRSQLADNEVT
34440|gene|hbo      QSG-------STVDAETLLDANPDVIFAL---------GGMHPKTSMADIRDGLGGNNVT
2190|gene|hut       ESA-------SVIDYEALLEADPDVILHL---------GGFEPNTDLAARREEFQSDPVA
5280|gene|hhi       ETN-------SVVDFETLLAADPDVILHL---------GGFEPNTSLPERREAFKSDPVG
7277|hp|hma         ETN-------SVVDFETLLEADPDIILHL---------GGFEPSTNLPKRREAFKSDPVG
31020|gene|hbo      FEG-----AQTQVDYEAMLEADPDVILVL---------FTMSSSYSISDVREALESSPVG
5358|gene|hhi       WDG-----LWGSVGYETMLDADPDVILHL---------WGMTPRYDMDDVRERLASHSVG
7190|gene|hma       WDG-----LWGSVGYETMLEADPDVILHL---------WGMTPRYDMDDIRGRLESHSVG
25280|gene|hbo      WGG-----LWGSVDFEAVAEADPDVILHL---------WGMTPNYQMSDVRAALDSHPVG
1720|hp|nrc1        WAS-----LWGTVGYETMLDADPDVILHL---------WGATPNYEMDAVRSRLRGDAVG
32830|gene|hbo      IEA-------GTIDYETLLEVDPEILVVHWGISTTGDQDTFSPKAFREQFVTPFEEDPTG
2549|chp|nrc1       IDA-LSQSQRSEIDAETLLNVDPDVLFVR------GH-EDKTAAEFQDTVVSFLQNHDTA
65275|gene|hma      VGH-YSGNTSLKVDFETLLDIDPDVLLVR------GQ-VEEDQATFEETIVDSLRNNPVA
10299|hp|hma        IQS-F-TSDRGTIDYEPLLEIDPEVLLLY------TD-THRTDTAFEDTYRSFLQDHDTA
5131|gene|hhi       IEG---YSGSESLDYEALLEIDPDSLLLR------YHREGKTREEFENSVLAHMKEHEVG
7041|hp|hma         VEG---YSGSESLDYETLLEIDPDSLLLR------YHREGKTREEFENSVLASMKDHEVG
1535|gene|hhi       VRD--FHADRSKVDFETLLDIDPEYLLLR------GQ-ENKTRSEFEDTVVSFLKSDQSG
10899|hp|hma        VRD--FHADRSKVDFETLLDIDPEYLLLR------GQ-ENKTRSEFEDTVVSFLKSDQSG
33590|gene|hbo      ITD---AQAGGTIDYETLLEIDPDALAIR------LQ-GEITPEYFEENIVSHLKNHDVA
15980|gene|hbo      VKG-ISSTNRTKIDYEQLLEVDPDTLLLK------GH-ETKTEAEFQNTLVKHMKNHDIG
2189|gene|hut       IEG-LSTTDRGELDYENLLTVDPDVLLVR------GH-ERKSAQEFRDTVLAYMEDHPVG
35980|gene|hbo      IEN-LSTDNRGELDYENLLEVDPDVLLIR------GH-EQKSASEFRDTVLAYMKDHPVG
4296|gene|hhi       IEN-QSTTGNMDLDYEGLLDLDPDVILFR------NF-AEMSVEEFRNTILAYMEDHPVG
3350|gene|hbo       IHG-ISTTDRGRIDYETMLEIDPDVIMLR------AH-ERKSATEFRETVLEFMRDHPVG
5132|gene|hhi       IEN-LSTTNRGEYDYETLLSVDPDVILVR------GH-ERKSATEFRETVLQFMQDHSVG
7040|hp|hma         IEN-LSTTNRGEYDYETLLSVDPDVILIR------GH-ERKSATEFRETILQFMQNHTVG
                                   : :                                          

36610|gene|hbo      SDIDIVDLETALDGADAVVVCAGHDAFCDINPAEAADLMDGRVIVDSFS---------IL
37770|hp|hbo        RGLITVDDDPERAI--------ARIDESGIVAQFELEWETR--YADAM------------
5038|gene|hhi       QELTAVQEDELYVG--------GSAYQGPIINLFQTEMLGKQLYPDEFGEWPGEITAGEL
35640|gene|hbo      QRLTAVQNDRLYPG--------GTGSQGPIINLFQTEMLAKQLYPAEFGPWRG------L
4213|gene|hhi       SELTAVQNENFVRS--------AGTNMGPIIDLFSVEAVAMQLYPDEFGEWPG-----SV
33120|gene|hbo      SQLRAVENGNFVRT--------GGQYMGPIIDLFSTEALAKQLYPDEYGEWPG-----SI
5009|gene|hhi       QDLTAVQEGNIIRI--------GGQYQGPIVDLFATEAAAKQVWPDRFGEWPG-----PV
7800|gene|hbo       QELTAVKEGNLVRT--------GGQFMGPIVDLYSTEALAKQVFPEAFGEWPG-----AL
2562|hp|nrc1        QQLTAVENGNLVRT--------GGQFMGPIVDLFSTEALAKMVYPDAFGSWPG-----SP
537|gene|hla        GELSAIENDRFYPS--------GNPVQGPIMNLFQIEMTAKQLFPERFGEWPAYELGDGY
19640|gene|hbo      KKITAVEEGQVYVQ--------GTRRQGPLLNLFQLEMTAKQLYPDQFGEWPGYTNGEPY
5133|gene|hhi       RKITAVQEGRIYAQ--------GARRQGPILNLFQTEMTAKQLYPDQFGEWPGYVDGEPY
7039|gene|hma       REITAVQEGRIYAQ--------GARRQGPILNLFQTEMTAKQLYPNQFGEWPGYVDGDPY
34440|gene|hbo      REVAAVKNDRVYAQ--------GARYQGPILNLFQIEMTAKQLYPDQFGAWPTYAEG-PY
2190|gene|hut       SEITAVQSERVYPQ--------GARYQGPILNLFQLEMTAKQLYPDQFGEWPRYTEG-PY
5280|gene|hhi       SEITAVQNDRIYPQ--------GARYQGPILHLFQLEMTAKQLYPEQFGEWPTYTEG-PY
7277|hp|hma         SEITAVQTDRIYPQ--------GARYQGPILHLFQLEMTAKQLYPEQFGEWPTYTEG-PY
31020|gene|hbo      SEIAAVKNDRVYAQ--------GARYQGPIMNLFQLEMTAKQVYPEVFGEWPGYADGEPY
5358|gene|hhi       KELAAVKDDRVYAH--------GMRYHGPIMNLFQIEMTAKQLYPDIFGEWPPYENGDHY
7190|gene|hma       KELAAVQTDRVYAH--------GMRYHGPIMNLFQIEMTAKQLYPDIFGEWPTYENGDHY
25280|gene|hbo      SELTAVQEDRVYPA--------GMRYQGPIMNLFQLEMGAKQLYPDVFGEWPEYTDGEPY
1720|hp|nrc1        GRLSAVANNRVYAS--------GMRYQGPIMNLFQLEMTAKQLYPDVFGAWPGFEDGGSY
32830|gene|hbo      SQLTAVQEGNVYPG--------AFGSQGPLVNLLQTELVAQQLYPEEFGAF----DAETF
2549|chp|nrc1       GRITAVENGDVYRG--------GPIYLGPIQHLFLTERLATALYDQ--------------
65275|gene|hma      SELTAVQNDAVYRG--------GYLDQGPIINLFQTEAAAQRIYSDEF------------
10299|hp|hma        SQLTAVQNGAVYPA--------GGMYQGPIINLSKTERAAKQLFPDEFD-----------
5131|gene|hhi       SRLRAVQNDRVFRG--------GPIYTGPLHNLFMIERYAKRYFPETF------------
7041|hp|hma         SQLRAVQNDMVFRG--------GPIYAGPLHNLFMIERYAKRYFPEEF------------
1535|gene|hhi       SELTAVQNGNVYRG--------GPLYQGPITNLVLTERAASQVYD---------------
10899|hp|hma        SELTAVQNGNVYRG--------GPLYQGPITNLVLTERAASQVYE---------------
33590|gene|hbo      SQLRAVQNDRVVYG--------GLTYQGPIIHLFQLERAAQGLYPDEF------------
15980|gene|hbo      SQLTAVKNDRVFRG--------GPTYQGPIHNLFLVERTAKDLYPDTF------------
2189|gene|hut       SELTAVQNGQVYRG--------GFLYQGPIQNLFLTERAAKQLYPETFG-----------
35980|gene|hbo      SELTAVQNNRVYRG--------GYLRQGPIHNLFLTERAAKQLYPDVFG-----------
4296|gene|hhi       SQLTAVKNGRVYRG--------GYLHQGPIHNLFLTEQAAKQIYPDVFG-----------
3350|gene|hbo       SELTAVQNGRVYRG--------GYLYQGPIHNLFLTERGAKQLYPDVFG-----------
5132|gene|hhi       SQLTAVQNGRVYRG--------GYLRQGPIHNFFLTERAAQQLYPDIFG-----------
7040|hp|hma         SQLTAVQNERVYRG--------GYLRQGPIHNFFLTERAAQQLYPNIFG-----------
                      :  :                .      :      :                       

36610|gene|hbo      DAVTWREHGFDYAAI------------------
37770|hp|hbo        -SREYDIESFDVRRLVDGMRTVMEYHVASYGQK
5038|gene|hhi       PAIPEDEQLFDRDELADILAESS----------
35640|gene|hbo      GETPTDEQLFDRQRVADIINGDL----------
4213|gene|hhi       GDVPTEHQLFDRQRVADIINGRV----------
33120|gene|hbo      HDVPEEEQLFDRQRVADIINGNV----------
5009|gene|hhi       RDVPDEEKLFDRQAVSDIINGNI----------
7800|gene|hbo       GSVPEDEQLFDRQRVADIINGDL----------
2562|hp|nrc1        TEIPASERLFDRQRVADAINGVGL---------
537|gene|hla        PDIPDDERLFDRDRVAGIVTGEAE---------
19640|gene|hbo      PEIPADEQLFDRQRVADIVSGDN----------
5133|gene|hhi       PELPVEEQLFDRQRVADVITGEGQ---------
7039|gene|hma       PEIPAEEQLFDRQRVADIITGAGQ---------
34440|gene|hbo      PEIPEDEQLFDRERVASIIRGNF----------
2190|gene|hut       PEIPAGEQLFDRERVAAVINGDI----------
5280|gene|hhi       PEIPAEEQLFDRKRVADIINGGFEA--------
7277|hp|hma         PEIPPEEQLFDRQRVADIVNGDI----------
31020|gene|hbo      PEIPESEQLFDRQRVADIVNGAI----------
5358|gene|hhi       PEIPSDEQLFSRDRVAQIVTDG-----------
7190|gene|hma       PEIPSAEQLFSRDRVANIITDG-----------
25280|gene|hbo      PEIPEEEQLFDRTKVAAAVNGEL----------
1720|hp|nrc1        PALPASERLFDRSRVAAIVTGDAQ---------
32830|gene|hbo      PEVPAEQQLFDRQRVSDIINGDI----------
2549|chp|nrc1       ----VTTTLFDRAELASIITD------------
65275|gene|hma      ----SEETVFDRQRVADIITGST----------
10299|hp|hma        ----EEETLYDRQRIADIRAGDI----------
5131|gene|hhi       ----TEAQLFDRERLARIITEGVAE--------
7041|hp|hma         ----TETHLFDRDHLATIITDGRDE--------
1535|gene|hhi       ----VDRNLFDRQRVADIVAGEL----------
10899|hp|hma        ----VDRELFDRQRVADIVAGDL----------
33590|gene|hbo      ----AGEQLFDRKRVSDIVNGDF----------
15980|gene|hbo      -----SGELFDRQRVADIVTGDF----------
2189|gene|hut       -DVTGDDELFDRQRVADIVNGEI----------
35980|gene|hbo      -DVTSDTKLFDRQRVADIINGDI----------
4296|gene|hhi       -DVTDDTELFDRQRVADIVNGDFYSNN------
3350|gene|hbo       -DVTSDEKLFDRQRVADIVTGEF----------
5132|gene|hhi       -DVTSDTELFDRERLADIVTGEFE---------
7040|hp|hma         -DVTSDTELFDRQQIANIVTGDFE---------
                             :.   :