HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0114COG1321arCOG02100Mn-dependent transcriptional regulatoriron-dependent repressor

HOG Organism Gene ID Name Annotation
cHOG0114 nrc1 VNG0530 troR iron-dependent repressor
cHOG0114 hmu HMUK2926 Hmuk_2926 iron (metal) dependent repressor, DtxR family
cHOG0114 hma RRNAC1825 idr iron-dependent repressor
cHOG0114 hwa HQ1710A sirR transcription regulator SirR
cHOG0114 hla HLAC0171 Hlac_171 iron (metal) dependent repressor, DtxR family
cHOG0114 hbo HBOR23560 Hbor_23560 Mn-dependent transcriptional regulator
cHOG0114 hut HUTA0078 Huta_0078 iron (metal) dependent repressor, DtxR family
cHOG0114 hut HUTA0381 Huta_0381 iron (metal) dependent repressor, DtxR family
cHOG0114 hvo HVO_0863 HVO_0863 troR iron-dependent repressor
cHOG0114 nph NP1496A transcription regulator
cHOG0114 hhi 2351 idr iron-dependent repressor
MUSCLE (3.6) multiple sequence alignment


78|gene|hut         MSHHSESATSESVEMYLKEIYLLSR-DGEAARTGAIADRLGVSPPSVTQMLSRLQEQDLL
1710|gene|hwa       ---------MNTADQYVEAIYLEQQIENGPVSTGVLADRLDISPASANDMIGKLETRGLI
530|gene|nrc1       ---------MNTADQYLKTIFLVEQLTDGPAATGELADRLGVSPASVNEMVGKLEDRGLV
381|gene|hut        ---------MNTAEQYLKAIYLVQKQEDGPAPTGRIAERLGVSPASANEMVGKLEDRDLL
11825|gene|hma      ---------MNTQAQYLKAIYLTQQQEDGPASTGDVADMLDVSPASANEMIGKLESRGLL
2351|gene|hhi       ---------MNTQAQYLKAIYLTQQQEDGPASTGDVADMLDVSPASANEMIGKLENRGLL
1496|gene|nph       ---------MNTQAQYLKAIYLVQEREDGPASTGAIADMLEVSPASANEMIGKLEDQGLA
171|gene|hla        ---------MNTADQYLKTIYVVQKQEDGPASTGSVADALGVSPASANEMIGKLEDLGLA
23560|gene|hbo      ---------MNTADQYVKAIYLLQEMEDGPAATGALADMLDVSPASANEMIGKLEDRGLA
                              ::   *:: *:: .   . .. ** :*: * :**.*..:*:..*:  .* 

78|gene|hut         EYQKRRGAELTERGTEQARDLLAKHCLIERFLVEGLDVTDGFHDEACRLEHALSDDVAAR
1710|gene|hwa       DHEKYTGVTLTDKGIARAREALETYCIIERFLTNILAVES-FQTEADELEPVIDELVAER
530|gene|nrc1       THEKYKGASVTEDGAARARDALQTYCILERFLANVLGVES-FRDEARQLEPVIDETVAER
381|gene|hut        EHEKYTGVTLTDDGIARARDALQTYCIIERFLVQVLDVKD-FRGEAKQLESVIDETVAER
11825|gene|hma      NHEKYKGVDLTDDGIAQAREALQNYCIIERFLIEVLEVEE-FRAEAKQLEGVIDETVADR
2351|gene|hhi       NHEKYKGVDLTDDGIAQAREALQNYCIIERFLIEVLEVEE-FQAEAKQLEGVIDETVADR
1496|gene|nph       DHEKYKGVSLTDEGIVQAREALETYCIIERFLWEVLEVED-FRTEARQLEAVIDETVAER
171|gene|hla        EHEKYKGVQLTDDGIVRARDALQTYCIIERFLANVLAVED-FREEAHELEAVIDDTVAER
23560|gene|hbo      EHEKYKGVRLTDEGIIRARDALQTYCIIERFLANVLDVEE-FRSEARELEPVIDDTVAER
                     ::*  *. :*: *  .**: * .:*::**** : * * . *. **  ** .:.: ** *

78|gene|hut         LTRYVERRPECPDCYDAEAKHCQHLEIEPE----------
1710|gene|hwa       LDTIIDRHPDCPDCFDPETDACCYLDIATELSDTNEQRAD
530|gene|nrc1       LDMIIDRKSQCPDCFDAGADACGFL---AEPSVEADD---
381|gene|hut        LDTIIDRPGECPDCFDADGDVCGRLDVEAE----ASD---
11825|gene|hma      LDTIINRKPQCPDCFDSEGDVCGLLEVEAEV---TSD---
2351|gene|hhi       LDTIIDREPQCPDCFDPEGDVCGLLEVEAEV---TSD---
1496|gene|nph       LDTIIDRNDRCPDCFDAEADACELLDIELETE--PAD---
171|gene|hla        LDTIIDRQPECPDCFDPETDACACLEIAATPIE-PEQ---
23560|gene|hbo      LDTIIDRNSECPDCFDPETDACCYLELASEPEEKPAD---
                    *   ::*   ****:*.  . *  *