HOG Organism Gene ID Name Annotation
aHOG1130 hhi 1309 HAH_1309 hypothetical protein
aHOG1130 hbo HBOR22690 Hbor_22690 hypothetical protein
aHOG1130 hla HLAC0800 Hlac_800 hypothetical protein
aHOG1130 hmu HMUK3125 Hmuk_3125 conserved hypothetical protein
aHOG1130 hut HUTA0886 Huta_0886 conserved hypothetical protein
aHOG1130 hwa HQ1666 hypothetical protein
aHOG1130 nph NP1390 hypothetical protein
aHOG1130 hma Hma_10655 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


1390|hp|nph       ------------------MTSRVYRLHSTLELQLEDVHEFFD-GYDLPVEIEDVDVTRRN
800|hp|hla        ------------------MTGRVFRLHSTLELPLEDVETYFEEDPDLPPEIDDIDITRRN
22690|hp|hbo      ------------------MSGRVYRLHSTLELPLEDVMEFFENDPELPPEVEDVEVTRRN
1666|hp|hwa       ------------------MSGRVYRLHSTLELPLEDVEAFLNGDPDLPTEIESIELTRRN
886|chp|hut       ------------------MTSRVYRLHSTLELPLEDVHDHFD-DPDLPEAIDDVEITRRN
1309|hp|hhi       ------------------MTSRVYRLHSTLELPLEDAYDFFE-DPDLPPEIADIDITRRN
10655|hp|hma      MTTASADGLRRLIHASPTMTSRVYRLHSTLELPLEDAYDFFE-DPDLPPEIADIDITRRN
                                    *:.**:******** ***.  .:: . :**  : .:::****

1390|hp|nph       NTLIVSAIAAEDNISKYTPTAQLKASVTENRLYETEDGWQETPPEDHESGSTGSDDGPQW
800|hp|hla        NTLIIKALSDDESISKYTPTAQLKASVTETRVWE-EE-----PPRA-------G--GPQW
22690|hp|hbo      NTLILKAVAADDNLSKYTPTAQLKASVTENRVYE-EE-----PPRA-------G--APRW
1666|hp|hwa       NTLILKAVAADDNLSKYTPTAQLKASVTENRVYE-EE-----PPRG-------G--NPRW
886|chp|hut       NTLILSAVADDESISKYTPTAQLKASVTENRVYE-EEPE---PPRG-----TGG--GGQW
1309|hp|hhi       NTLIVSAVAKDDSMSKYTPTAQLKASVTENRVYE-EDPDEMGPPGAASTGSSGG--GPQW
10655|hp|hma      NTLIVSAVAKDDSMSKYTPTAQLKASVTENRVYE-EDPDEMGPPGAASTGSAGG--GPQW
                  ****:.*:: ::.:***************.*::* *:     **         .    .*

1390|hp|nph       GNFSDGAQVQEEEVEVNSKLVEYACFKGDRETVLQNTALQYPMFEVLCDLAKYADSGTLT
800|hp|hla        M---D-----DEEEEIPSELVEFACFKGDRETVLQNSALQYPMFLVLRKIATLSEKGTLT
22690|hp|hbo      G---------EEEEEIPSELVEFACFKGDRETVLQNTALQYPMFLVLQEIAKIAEKGTLT
1666|hp|hwa       T---D-----EEEEEIPSELVEFACFKGDRETVLQNTALQYPMFRVFRQISLLAEKGTLT
886|chp|hut       GALAE-----EEEEEIESELVEYACFKGDRETVLQNTSLQFPMFEVLCGIAEIAEKGTLT
1309|hp|hhi       GAL-E-----EEEEEIESELVEYACFKGDRETVLQNTALQYAMFEVLCEVAKVAEKGTLT
10655|hp|hma      GAL-E-----EEEEEIESELVEYACFKGDRETVLQNTALQYAMFEVLCEVAKVAEKGTLT
                            :** *: *:***:*************::**:.** *:  ::  ::.****

1390|hp|nph       AIATVDGELEAVRIVDGEQREASIEVVEDP-RERDSENAVNWRDNEFISG
800|hp|hla        AITEEDGELEATRIVEGEPRPASIEVVESPQGAGDGDGGVNWRDNEFISD
22690|hp|hbo      AITESDDELHATRIVEGEERPATIEVVENPSKGGSGSGGVNWRDNKFIS-
1666|hp|hwa       AITEINEELSAHRIVEGEERPATIEVVENPSQNENGSGGVDWRDNKFISD
886|chp|hut       AIIAIDEELRAVQIVDGERTPASITVTEDP-ADDQGEDGVDWRDNEFIH-
1309|hp|hhi       AIAAVDEELEAVRIVDGEERPAAINVAEEP-RDGEEEEGVNWRDNEFIS-
10655|hp|hma      AIAAVDEELTAVRIVDGEERPAAINVAEEP-RDGEEEEGVNWRDNEFIS-
                  **   : ** * .**:**   *:* *.*.*    . . .*:****:**