HOG COG KOG arCOG COG description NRC-1 annotation
cHOG0113COG2896arCOG00930Molybdenum cofactor biosynthesis enzymemolybdenum cofactor biosynthesis protein

HOG Organism Gene ID Name Annotation
cHOG0113 nrc1 VNG0085 moaA molybdenum cofactor biosynthesis protein
cHOG0113 hmu HMUK2500 Hmuk_2500 molybdenum cofactor biosynthesis protein A
cHOG0113 hmu HMUK1555 Hmuk_1555 molybdenum cofactor biosynthesis protein A
cHOG0113 hma RRNAC1314 moaA molybdenum cofactor biosynthesis protein A
cHOG0113 hwa HQ2948A moaA molybdenum cofactor biosynthesis protein A
cHOG0113 hla HLAC1859 Hlac_1859 molybdenum cofactor biosynthesis protein A
cHOG0113 hbo HBOR12600 Hbor_12600 GTP cyclohydrolase subunit MoaA
cHOG0113 hut HUTA0169 Huta_0169 molybdenum cofactor biosynthesis protein A
cHOG0113 hvo HVO_2789 HVO_2789 moaA probable molybdenum cofactor biosynthesis protein A
cHOG0113 nph NP2822A moaA molybdenum cofactor biosynthesis protein A
cHOG0113 hhi 1904 moaA molybdenum cofactor biosynthesis protein A
MUSCLE (3.6) multiple sequence alignment


169|gene|hut        ----------MLEDDFGRELTGLRVSLTDRCNFDCVYCHNEGLGDTRGPMAPSEEELSTD
85|gene|nrc1        MRPVPGTSETMLEDDFGRDVSGVRVSLTDRCNFDCVYCHNEGLGDTRGPIDPRENELSTD
11314|gene|hma      ----------MLEDDFGREVSGVRVSLTDRCNFDCVYCHNEGLGDTRGPMEAQDDELTAD
1904|gene|hhi       ----------MLEDDFGREVSGVRVSLTDRCNFDCVYCHNEGLGDTRGPMEAQDDELTAD
2822|gene|nph       ----------MLEDGFGRETTGVRISLTDRCNFDCVYCHNEGLGDTRGPMEPAEDEMSTD
1859|gene|hla       -------MTGPLADDFGREVTGVRISLTDRCNFDCVYCHNEGLGDTRGPMEPSDDEMTAD
2948|gene|hwa       ----------MLEDEFGREVSGVRVSLTDRCNFDCVYCHNEGLGDTRGPMDPQDDEMSTD
12600|gene|hbo      ----------MLVDDFGREVSGVRISLTDRCNFDCVYCHNEGLGDTRGPMEPSDDEMSTD
                               * * ***: :*:*:************************: . ::*:::*

169|gene|hut        EVVRVIEVAADHGVEAVKFTGGEPMLRTDLGEIVRRTPAGVETSMTTNGTFLPDRAAELA
85|gene|nrc1        RVVRFLSVAHEFGVDAVKLTGGEPMLRSDLEAIIRRTPDDMAVSMTTNGTFLPGRAADLV
11314|gene|hma      TIVAFLEVAAEFGVDSVKFTGGEPMLREDLEEIVRRAPDEMEVSMTTNGTFLPGRAPDLV
1904|gene|hhi       TIVAFLEVAAEFGVDSVKFTGGEPMLREDLEEIVRRAPDEMEVSMTTNGTFLPGRAPDLV
2822|gene|nph       DVIRFLEVAAEFDIQSAKFTGGEPMLREDLETIVRRTPDSIETSLTTNGTFLPDRATALV
1859|gene|hla       DVVRFLEVVEGYGVDSVKFTGGEPMLRQDLEEIVERTPDSMEVSLTTNGTFLPGRAEDLK
2948|gene|hwa       DVVRFLEVVSQFDIGKVKFTGGEPMLRDDLTEIIRRTPSSMEVSMTTNGTFLPGRAGALR
12600|gene|hbo      DVVRFLEVVEEFGVEKVKFTGGEPMLRQDLAEIIRRTPESMESSLTTNGTFLPGRAEDLK
                     :: .:.*.  ..:  .*:******** **  *: *:*  :  *:********.**  * 

169|gene|hut        DAGLERVNVSQDALDPEDFATLTQSGAYDQVLSGVEAALDAGLAPVKLNMVVFEHTAGYV
85|gene|nrc1        DAGLERVNISQDAMDNDAFAELTQSGAYDAVLEGVEAALDAGLAPVKLNMVVFEPTAGYV
11314|gene|hma      DAGLERVNVSQDALDSEAFAELTQSGAYDRVLEGVEAALDAGLEPVKLNMVVFEPTAGYV
1904|gene|hhi       DAGLERVNVSQDALDSEAFAELTQSGAYDRVLEGVEAALDAGLAPVKLNMVVFEPTAGYV
2822|gene|nph       DAGLERVNVSQDALSPKAFQTVTKSSAYDDVMAGIDAALDAGLAPVKLNMVVFEQTAGYV
1859|gene|hla       AAGLDRVNVSQDALDPDDFAEVTKSGAYERVLEGVKAAVDAGLDPVKLNMVVFTHTAGYV
2948|gene|hwa       EAGLERVNVSQDALDPDEFAEITKSGAYDRVLEGVEAAVDAGLAPVKLNMVVFEHTAEYV
12600|gene|hbo      EAGLSRVNVSQDALDPEAFAEITKSGAYDNVLEGVQAALDAGLDPVKLNMVVFEHTAGYV
                     ***.***:****:. . *  :*:*.**: *: *:.**:**** *********  ** **

169|gene|hut        PEMVEHVADGDGLRLQLIEYMPELAGRPEWAIDIDRVHDWLAEQATEVTAREMHDRTRYW
85|gene|nrc1        PEMVDHVAARDGLRLQLIEYMPELAGHPEWAIDIDRVHDWLADRADRIETREMHDRRRYW
11314|gene|hma      PKMVDHVAENPGLQLQLIEYMPELAGHPEWAIDIDRVHDWLEDRADKVEHREMHDRKRYW
1904|gene|hhi       PKMVDHVAENPGLQLQLIEYMPELAGHPEWAIDIDRVHDWLEDRADTVEHREMHDRKRYW
2822|gene|nph       PEMVDHVADNEGLQLQLIEYMPELAGRPEWAVDIERVHEWLADQADRVDRREMHGRNRYF
1859|gene|hla       EEMVEHVADNEGLQLQLIQYMPELTGKPEWNVDIERVHDWLAEKADRVERREMHDRKRYF
2948|gene|hwa       EDMVNHVSENAGLQLQLIEYMPELTGHPEWNIDIQRVHDWLADIADRVETREMHDRNRYF
12600|gene|hbo      EEMVDHVAENPGLQLQLIEYMPELTGRPEWNIDIQRVHDWLEGKADRVEMREMHHRRRYY
                     .**:**:   **.****:*****:*.*** :**:***:**   *  :  **** * **:

169|gene|hut        I--DGTPDDGD----------------------GGLVEVVDPVGNTDFCENCHRVRVTHD
85|gene|nrc1        VSSRDAGSTADDAAQSV-TPDGGAHPD------QGMVEIVDPVGNPQFCANCHRVRLTHD
11314|gene|hma      MHSGEAAVEGDSASTSLAASDGGIRTEPVNNHNSGMVEIVDPVGNENFCANCHRVRLTHD
1904|gene|hhi       IHSTEAAVEGSGATTSLAASDGGVQTEPVNNQNSGMVEIVDPVGNENFCANCHRVRLTHD
2822|gene|nph       V--------GEDDPDRP----------------GGMVEIVDPVGNADFCANCHRVRVTHE
1859|gene|hla       V--------GEDSDDDT----------------GGMVEIVDPVENENFCANCGRVRVTHE
2948|gene|hwa       V--------GD-----------------------GMVEIVDPVENPTFCANCHRVRVTHE
12600|gene|hbo      V--------GQ-----------------------GMVEIVDPVENEDFCANCHRVRVTHE
                    :        ..                       *:**:**** *  ** ** ***:**:

169|gene|hut        GYLKGCLNRNDDLRSLGDRSREAIEAALRDTVAERVPYYGEYLIEDDNGEWVRNPAYEGS
85|gene|nrc1        GYLKGCLNRNDDLRGIGE-TTQSMRAAFRETVANRVPYYGEYMTRTDDGGWEINDDYLDV
11314|gene|hma      GYLKGCLNRNDDLRDIGT-TKESMRAAFRETVDTRVPYYGEYMIETEDGEWEINEEYIDT
1904|gene|hhi       GYLKGCLNRNDDLRDIGT-TKESMRAAFRETVDTRVPYYGEYMIETEDGEWEINEEYIDT
2822|gene|nph       GYLKGCLNRNDDLKSMGEMTKPEIREAFRETVDERVPYYGEYMVQDENGEWRFNEEYISA
1859|gene|hla       GYLKGCLNRNDDLRSMGEMTRDEIAETFEAVVANRVPYYGEYLIENDDGEYELNEKYLGT
2948|gene|hwa       GYLKGCLNRNDDLRSMGEMTREEIRETFRETVANRVPYYGEYLIKENDE-WVLNDKYLDA
12600|gene|hbo      GYLKGCLNRNDDLRPMGQMTRGEIREAYRETVANRVPYYGEYLVQDEDDEWVINEKYIGA
                    *************. :*  :   :  :   .*  ********:   ::  :  *  * . 

169|gene|hut        KGDRAPYEYENDAPGSERADDQPATEKGGEDASHAATDGGESTGSVPDN
85|gene|nrc1        EGDRDPYEYAADDSA----------------------------------
11314|gene|hma      DGDRAPYEYSE--------------------------------------
1904|gene|hhi       DGDRAPYEYSE--------------------------------------
2822|gene|nph       -------------------------------------------------
1859|gene|hla       PSTAD--------------------------------------------
2948|gene|hwa       PTTHS--------------------------------------------
12600|gene|hbo      -------------------------------------------------