HOG Organism Gene ID Name Annotation
aHOG1118 hhi 953 dapA dihydrodipicolinate synthase
aHOG1118 hbo HBOR22900 Hbor_22900 dihydrodipicolinate synthase( EC:4.2.1.52 )
aHOG1118 hla HLAC0667 Hlac_667 dihydrodipicolinate synthase
aHOG1118 hmu HMUK3171 Hmuk_3171 dihydrodipicolinate synthase( EC:4.2.1.52 )
aHOG1118 hut HUTA0979 Huta_0979 dihydrodipicolinate synthase
aHOG1118 hwa HQ1507 dapA dihydrodipicolinate synthase
aHOG1118 nph NP1490 dapA dihydrodipicolinate synthase
aHOG1118 hma Hma_10207 dapA dihydrodipicolinate synthase
MUSCLE (3.6) multiple sequence alignment


1490|gene|nph       -------------------MTHDTFTGVFPAMTTPFDDEERIDHETLRDHAQRLEAAGVD
667|gene|hla        MTDTTTTTPYATQDETDRETTDEPFEGVYPAMTTPFTDDDEVDHEQLAANARYLERAGVD
1507|gene|hwa       -------------------MTDIDLTGVFPAMTTPFTPDGRIDHDILAQNAQRLETAGVS
22900|gene|hbo      -------------------MTNFDLTGVYPAMTTPFAPDGSIDHETLADDTRRLERAGVD
979|gene|hut        ------------------MPPQPLFEGVYPAMTTPFEDDERIDFDQLRANARRLEAAGVD
953|gene|hhi        -------------------MTAIDFRGVFPAMCTPFHQDGSIDFETLQEDAQRLESAGVD
10207|gene|hma      -------------------MTAIDFHGVFPAMCTPFHQDGSIDFETLRDDAQRLESAGVD
                                        .   : **:*** ***  :  :*.: *   :. ** ***.

1490|gene|nph       GLVPVGTTGESATMSHDEHIEVVETVVDAVDDVPVIAGSGSNNTREALELSERAADAGAD
667|gene|hla        GVVPVGSTGESATMSHDEHVDVIETVRDALEDVPVVAGTGSNNTAEALSLSERAADAGAD
1507|gene|hwa       GLVPAGSTGESATLTHDEHIDVIETVIDSVNDVPVIAGSGSNSTREALNLSERAADAGAD
22900|gene|hbo      GLVPVGSTGESATLTHDEHIEVVETVVEAAEDVPVIAGSGSNSTREALELSRRSADVGAD
979|gene|hut        GVVPVGSTGESATLSHDEHVEVIEAVAGALKDVPVIAGTGSNNTREALSLSRRARDAGAD
953|gene|hhi        GLVPVGSTGESATLSHDEHIEVVEAVIDAVDDVPVIAGSGSNNTKEALELSRRSAEAGAD
10207|gene|hma      GLVPVGSTGESATLSHDEHIEVVEAVIDAVDDVPVIAGSGSNNTKEALELSRRSAEAGAD
                    *:**.*:******::****::*:*:*  : .****:**:***.* ***.** *: :.***

1490|gene|nph       GLLLISPYYNIPEPEGMETHYRTVADAVDLPQIIYNVPGRTGRNIAVETAVSLAEHENIV
667|gene|hla        GLLLISPYYNKPEPQGFLEHYRTIADEVDLPQIVYNVPSRTGQSIPIDVTVELAEHPNIQ
1507|gene|hwa       ALLLISPYYNIPEQAGLKDHYRTIADAIDIPQIVYNVPGRTGTNIEPETVATLASHRNIV
22900|gene|hbo      GLLLISPYYNKPEQAGLIEHYQTIADEVDVPQIVYNVPSRTGSNIEPATVATLADHENIA
979|gene|hut        ALLLISPYYNKPEQRGLREHYLTIADEIDLPQIVYNVPSRTGRNIDPDTAVALADHENIQ
953|gene|hhi        ALLLISPYYNKPEQQGFLDHYTTLADAVDLPQIVYNVPSRTGQNIDPDTAVELAAHPNIR
10207|gene|hma      ALLLISPYYNKPEQQGFIDHYTTLADAVDLPQIVYNVPSRTGQNIEPDTAAELASHPNIR
                    .********* **  *:  ** *:** :*:***:****.*** .*   ... ** * ** 

1490|gene|nph       GYKAASGDLNRVGEVIERTREENFEVLSGDDALTLPIIAQGGTGCISVSANVEPERTVAL
667|gene|hla        GYKAASGDLNLISEVIERTRDEEFSVLSGDDGLTLPVLSIGGTGTISVVGNVEPERSCAM
1507|gene|hwa       GYKAASGDVGQISSVVEQTRSEAFYILSGDDILTLPICGLGGSGVISVGANIEPAQTTAM
22900|gene|hbo      GYKAASGDIGQISEVVERTREQEFAILSGDDALTLPVISVGGHGVISVTGNIEPERTAAM
979|gene|hut        AFKAASGDLGQITEIVERTREKDFTVLSGDDALTLPMLSIGARGAISVVANVEPVRTCAM
953|gene|hhi        AYKAASGDMGQISEIIERTQDEDFAVLSGDDGMTLPMLSVGGTGCISVSANIEPERTCAM
10207|gene|hma      AYKAASGDMNQISEIIERTRDEDFAVLSGDDGMTLPMLSVGGTGCISVSANIEPERTCAM
                    .:******:. : .::*.*..: * :***** :***: . *. * *** .*:** .: *:

1490|gene|nph       VGAALEGDFTRARELQYELGDLFRTLFIETNPIPINEAMDMRDIHSSTMRSPLNPLQPEH
667|gene|hla        VGAALSGDYDRARALHHELSPLVRELFAETNPIPVKEAMHIRGRGGPSVRSPLSRLSEDR
1507|gene|hwa       VGAAVSGDYDRARNLHYQLAPLFEHLFVETNPIPVKAAMEYRDYGPGTLRPPLTDLSDKH
22900|gene|hbo      VHAALDGDFDSARELHHELGPLSRQLFIETNPIPVKAAMEIRGYAPGTLRPPLTELRDEH
979|gene|hut        VGAALAGDFERARELHHELGPLARALFVETNPIPVKEAMAIRGHGSPELRSPLTRLAEEH
953|gene|hhi        VGAALSGDFERARAIHHELGPLFRALFVETNPIPVKEAMRIRGYGPAYLRSPLTRLSDEH
10207|gene|hma      VGAALSGDFERAQAIHHELGPLFRAMFVETNPIPVKEAMRIRGYGPAHLRSPLTRLSDEH
                    * **: **:  *. ::::*. *   :* ******:: **  *.     :*.**. *  ..

1490|gene|nph       REQLREVLAD--------LER--------------
667|gene|hla        REILQELLAEYDGGAPGAVDPEAVEPTAGDAE---
1507|gene|hwa       RKRLESILDD--------LDADREMALAGQTEVI-
22900|gene|hbo      YEMLEATLEQ--------LEATREASLGLEPAGGA
979|gene|hut        RAHLRDVLDE--------LDPIDVETPVETTDR--
953|gene|hhi        LDHLRDVLAT--------LETEDLEDEYAEAER--
10207|gene|hma      LDHLRDVLAT--------LETEDLEDEYAEAER--
                       *   *          ::