HOG Organism Gene ID Name Annotation
aHOG1115 hhi 175 HAH_0175 hypothetical protein
aHOG1115 hbo HBOR01180 Hbor_01180 hypothetical protein
aHOG1115 hla HLAC0006 Hlac_6 hypothetical protein
aHOG1115 hmu HMUK1188 Hmuk_1188 conserved hypothetical protein
aHOG1115 hut HUTA1296 Huta_1296 conserved hypothetical protein
aHOG1115 hwa HQ3430 hypothetical protein
aHOG1115 nph NP0880 hypothetical protein
aHOG1115 hma Hma_12907 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


880|hp|nph        MGIFETVRQVLGLSAESGATRDADPEDLFGMSTAYLTMEAELGFAPTGDAALCFADVDST
6|hp|hla          MGIFDTIRAVLGTSAETDATREADPEDLFGMSTAYMTMEADLGYDHCGEAALCFSGVDST
1180|hp|hbo       MGFLDSIRSVLGISAEADATREADPEDLFGMSTAYITMEADLDFDPVGAAALCFSSVDST
3430|hp|hwa       MGLFDTIRSVFGTNAAADATRDADPEDLFGMSTAYMTMGADLGFDSVGSAALCFSGVDST
175|hp|hhi        MGLLDGLKSVLGVKAEADATRDADPDDLFGMSTAYVTMEADLGYEPTGEAALCFADVDST
12907|hp|hma      MGLLDGLKSVLGVKAEADATRDADPDDLFGMSTAYITMEADLGYEPTGEAALCFADVDST
1296|chp|hut      MGLLDGIKSALGLKAEADATRDADPEDLFGMSTAYVTMAADLGYEPAGEAALCFSDVDST
                  **::: :. .:* .* :.***:***:*********:** *:*.:   * *****:.****

880|hp|nph        AFREAREEVEAVLELGEAD-GTTADFIEDSHGYHWVVLHDTDFENLVSSIHFAADTLIEE
6|hp|hla          RFDDAVETVEAILEAGEIDTGTGFHRHEDDHGYQWFVLEDNDPEDLVTSIHFAADQFIEE
1180|hp|hbo       DFAQTVEEVEAILKAGEEETGTDFRLYEDSHGWEWVVLEDDDPEDLVTSIHFAADEFIER
3430|hp|hwa       DFADTVSDVEAILRAGGEETGTTFDLHEDSHGWEWVILQDDNPEDLVTSIHFAADEFIER
175|hp|hhi        DFQDAVDEVESILDAGMVETGTRATFETDDHGYQWVVLHDDDFEDLLTSIHFAADTLVER
12907|hp|hma      DFQDAIDEVESILDAGMVETGTRATFETDDHGYQWVVLHDNDFEDLLTSIHFAADTLVER
1296|chp|hut      DFQDAISEVRQILAAGEIETGTTAEFVEDAHGYTWVVLEDDDVEDLVTSVHFAADTLVEN
                   * :: . *  :*  *  : **      * **: *.:* * : *:*::*:***** ::* 

880|hp|nph        GFGSRLLAALFAFER---------DGTTAYWVYSFRRGAYYPFVPTGG--RQRDQKLEFK
6|hp|hla          GFGSRLLAAVFGFER---------DGVDAYWIYSFRRGAYYPFSPKGT--SDRNQQVEFK
1180|hp|hbo       GYGSRLLAAVFGFER---------DGDRAYWIYSFRRGAYYPFAPERG--RNQNDRILMK
3430|hp|hwa       GYGSRLLAAVFGFED---------AGERAYWIYSFRRGAYYPFAPRSG--NNRDQQLEFK
175|hp|hhi        RYGSRLLAALFAFEHAR-------ENQTVYWVYSFRRGAYYPFAPDPHDSHERNTSAEFK
12907|hp|hma      RYGSRLLAALFSFEDAR-------SDQTVYWVYSFRRGAYYPFAPDPHDSHERNTSAEFK
1296|chp|hut      GYGSRLLAAVFAFRDPEDSTAWDDSDRYVYWVYSFRRGSYYPFAPKPGE-RERDATAEFK
                   :*******:*.*            .  .**:******:**** *      :.:    :*

880|hp|nph        LESSFDGELAIEDDTSYWYPMWPEGDT-HPWG
6|hp|hla          LQSVLDGELGLEDDEAYWYPLWPDTPGNHPWE
1180|hp|hbo       LESVLDGELELEPDKEYWYPMWPDREGGHPWE
3430|hp|hwa       LESVLTGELTIEDDESYWYPMWPDARGGHPWQ
175|hp|hhi        LDSNLSDEITVEGDKEYWYPLWPDRPGYHPWE
12907|hp|hma      LDSNLSDEITVEDDKEYWYPLWPDRPGYHPWE
1296|chp|hut      LQSVLDGELDLEDDEAYWYPLWPEDEG-HPWE
                  *:* : .*: :* *  ****:**:    ***