HOG Organism Gene ID Name Annotation
aHOG1112 hhi 1196 HAH_1196 metallopeptidase
aHOG1112 hbo HBOR16740 Hbor_16740 Peptidase family M50
aHOG1112 hla HLAC0861 Hlac_861 peptidase M50
aHOG1112 hmu HMUK2747 Hmuk_2747 peptidase M50
aHOG1112 hut HUTA0435 Huta_0435 peptidase M50
aHOG1112 hwa HQ2667 membrane metallopeptidase
aHOG1112 nph NP2704 metalloprotease
aHOG1112 hma Hma_10437 metallopeptidase
MUSCLE (3.6) multiple sequence alignment


2704|gene|nph       -----------MTVDVAEIRFSEVELRDLAIAWVALGVAFSIFIFVATGRDVFPDITGAI
435|gene|hut        ------------MIELRSIRFSRKELLDLFAAWLILSVAFTLFLNPRLLERWSYAPDPTA
1196|gene|hhi       --MAGRRQRTAGGRTVGGLSFSQRELRDLLVAWLALGLAFTFFLEREFRRIVFGQF-GGL
10437|gene|hma      --MAGRRRRPTTDRTIGGLSFSQRELRDLLVAWLALGLAFTFFLEREFRRIVFGQF-GGL
861|gene|hla        ------MSGTLQGRRIAGLYFSGTEIRDLLVAWLALGVAFTFFFVNGTA-GFDRLLAAGI
16740|gene|hbo      ------------MSTNTTLSFSSRELRDLAVAWVALGLAFAIFFAGGGMRAIANVFGGGL
2667|gene|hwa       MPLDIGLYRMAHSRSSPEVSFSRRELRDLGIALIALSVAFAIFFAGGGARALSGILDRGV
                                      : **  *: **  * : *.:**::*:                

2704|gene|nph       LSPQFATVFVLSLVTVGVGFLLHELAHKVVAIRFGQAAAFRADYPMLALCVGAAFAGFLF
435|gene|hut        VIAAFGESLLTSLLTVGVGFMLHELAHKVVAIRFGQIAAFQADYGMLFLALVSAMAGFLF
1196|gene|hhi       STAEIASTFAVSLLTVGVGFLLHELAHKVVAVRFGQIAAFKADYRMLGFAVLGGLVGFLF
10437|gene|hma      SGAEIASTFAVSLLTVGVGFLLHELAHKVVAVRFGQIAAFKADYRMLGFAVLGGLVGFLF
861|gene|hla        VPP-----LLVGLLTAGVAFLLHEIAHKVVAVHYDQVAEFRADNSMLFLAVMSSLLGFIF
16740|gene|hbo      VGP-----FLVSLLTAGIGFLLHELAHKVVAVRFGQVAEFRADYGMLFLAVMSSLAGFIF
2667|gene|hwa       IIP-----ILVSLLTAGLGFLLHEIAHKVIAVRFGQLAEFRADYGMLFLAIVSSLAGFIF
                      .     :  .*:*.*:.*:***:****:*:.:.* * *.**  ** :.: ..: **:*

2704|gene|nph       AAPGAVHHRGRITPRENGLISVAGPVTNIVLVGVF-LPLVFVG-----GFVGAVGQLGVI
435|gene|hut        AAPGAVVHRGRITPRESGLIALAGPVTNLALAAAF-APFALLA----GPTISSVASFGVT
1196|gene|hhi       AAPGAVVHRGRLTAKQHGLIAVAGPVTNLALAVVFLVPFVAALLSSTGGFLWEVARMGLQ
10437|gene|hma      AAPGAVVHRGRLTAKQHGLIAVAGPVTNLALAVVFLVPFFLTASMGIGGFLRELTEMGLQ
861|gene|hla        AAPGAVHHRGRLTPREHGHIALAGPVVNLLLTLVF-LPALLLGPVVGSPVITLIGSRGIA
16740|gene|hbo      AAPGAVYHRGMLTDREHGLIALAGPVTNLALAALF-LPVLLIGALGGSDFVGLVGFRGVT
2667|gene|hwa       AAPGAVHHQGRVTSRQHGLIALAGPVTNAILTVIF-VPIYLAGLTLDSSLIILIGSRGLM
                    ****** *.* :* .: * *::****.*  *.  *  *            :  :   *: 

2704|gene|nph       INAFLAAFNMIPFGPLDGKSVLAWSKPVFGAVFTASVLLAVGSF-L----FVGFPSI
435|gene|hut        INLLLAGFNMIPYGPLDGRTVLEWNRGVYLAVAVPSIVLAIAGL-F----GFG---F
1196|gene|hhi       INLLLAGFNMLPFGPLDGRTVREWSTPVFLAVAVPSILLGVGAL-F----VL-----
10437|gene|hma      INLLLAGFNMLPFGPLDGRTVREWSTPVFLAVAVPSILLGVGAL-F----VL-----
861|gene|hla        INVFLAAFNLIPYGPLDGKTVLDWSKGVWAGFFVLSVVLTIGLV-FVGGLGFG-GPF
16740|gene|hbo      INLFLAAFNMLPFGALDGKTVISWSKGVFAVVFIPSLLLTLALV-F----GIT--PF
2667|gene|hwa       INLLLVAFNMLPFGALDGRTVYQWNPVVFAVVFIPALLLTIGAFII----GFG---F
                    ** :*..**::*:*.***.:*  *.  *:  .   :::* :. . :     .