HOG Organism Gene ID Name Annotation
aHOG1111 hhi 1427 HAH_1427 serine/threonine protein kinase involved in cell cycle control
aHOG1111 hbo HBOR20450 Hbor_20450 serine/threonine protein kinase involved in cell cycle control
aHOG1111 hla HLAC1143 Hlac_1143 protein of unknown function RIO1
aHOG1111 hmu HMUK3109 Hmuk_3109 protein of unknown function RIO1
aHOG1111 hut HUTA0586 Huta_0586 protein of unknown function RIO1
aHOG1111 hwa HQ2347 hypothetical protein
aHOG1111 nph NP4094 hypothetical protein
aHOG1111 hma Hma_10778 hypothetical protein
MUSCLE (3.6) multiple sequence alignment


586|hp|hut          MAVRRLLRGQIAWPQLEAIVETVLDRYDE--PAG-RVEFLDANNWLSVPLVVNDRYFVKI
4094|hp|nph         MPLRRLLRASVPHEQLEAIAAEVARRFDGGDPEAVDIELLEADNWLSVPCVVDDQWFVKV
1427|gene|hhi       MAFRRLLRGTVPWEQLEGVVRAVMERYDE--PAA-HVAFLEADNWLSTPLVVNDQWFVKV
10778|hp|hma        MAFRRLLRGTVPWEQLEGVVRAVIGRYDE--PAA-RVAFLEADNWLSTPLVVNDQWFVKV
2347|hp|hwa         MQVRRYVRGHIEWPRLEAVARELADRYGHTADSL-HIEFLDADNWLSTPMIVNERWFVKI
20450|gene|hbo      MELRRLVRGRVDWPRLEAVVRDLRDRYDR--EEL-HVRFLEADNWLSTPMVVDDEWFVKV
1143|gene|hla       MELRRLVRGRVDWPDIERVVRELADRYDR--DEM-RVRFLDADNWLSTPMVIDDDLFVKV
                    * .** :*. : .  :* :.  :  *:.        : :*:*:****.* ::::  ***:

586|hp|hut          ISRQHSLVHALLTTGRNLGAFTSGTEG--FFEHFGTPLEMAEHELEAAQRMQSVGVNVPE
4094|hp|nph         IGDQHTLMHALLTTGRNIGAFSAGTEG--FFERFASPVEMAEHELAATQRTRELGVAAPE
1427|gene|hhi       ITGQNSLVHTLLTAGRNIGAFSSGTEG--FFEHFGTPYEMAEHELAATRRMREIGVNAPE
10778|hp|hma        ITGQNSLVHTLLTAGRNIGAFSSGTEG--FFEHFGTPYEMAEHELAATRRMREIGVNAPE
2347|hp|hwa         ISKQNSVVHALLTAGRNLGAFSAGTEGEGFFEHFATPLEMAEHEFTAAKRMRKLGLNTPK
20450|gene|hbo      ISRQNSLVHALFTTGRNLGAFSSGTEG--FFEHFGTPLEMAEHELEATRRMREIGLNAPE
1143|gene|hla       ITRQNTIVHALFTTGRNLGVFSAGTEG--FFERYETPYEMALHELEATQKVREIGVNAPE
                    *  *::::*:*:*:***:*.*::****  ***.: :* *** **: *:.. ..:*: .*:

586|hp|hut          PVEAFEVADYGVLVFEYVPAFRTFEAVEVATARQLAPDLFVALDRMHQAGLAHGDLRSEN
4094|hp|nph         PIAAFEHDGYGVLVLEYLPDFRTFDALSPARAAEFAPTLFENLATLHAAGLAHGDLRAEN
1427|gene|hhi       PIEAFEYDGMGVLVLEYIPDFEPLDDLPAETVERHSPTVFDFLHRMHEDGLAHGDFRCEN
10778|hp|hma        PIEAFEYDGMGVLVLEYIPDFEPLDDLPTQTVERHSPTVFDFLNRMHKDGLAHGDFRCEN
2347|hp|hwa         PIETFEVDNLGILVSEYLPDFQTLDSLNQQAETDVAPIIFKMLRQMHEDGLYHGDLRAEN
20450|gene|hbo      PVESFEVDGLGILVLEYLQDFRTLDKLDREVEKRLAPQVFSSLRTMHDHNLVHGDLRAEN
1143|gene|hla       PIEALEVGDLGVVVLEYLPEFRTLDELDAEDVAALAPTLFETLRTIHDAGLAHGDLRAEN
                    *: ::*  . *::* **:  * .:: :        :* :*  *  :*  .* ***:*.**

586|hp|hut          VLVVEG-----ELYFIDATSVR-GDIADARAYDIACALGVLSPLLGPAETVGLAVEIFGA
4094|hp|nph         VLVAPDADGIETLYFIDATHVSEGAIEDARGYDIACALASLSPLVGPREAVTAATAVYSS
1427|gene|hhi       VLVAHD-----DLYFIDATSVREEAISDARAYDLACALGALEPLIGAPPAVSAAARHYDT
10778|hp|hma        VLVAHG-----DLYFIDATSVREAAIRDARAYDVACALGALEPLIGAPAAVSAAAQYYDT
2347|hp|hwa         ILLYED-----DVYFIDVTNVNEESVADAMAYDIACALGALEPHLGAKSTIDAALSSYTL
20450|gene|hbo      VLIVDD-----EVYFIDATNVSEEGAADAKSYDLACALAAIEPLIGAKSTVNAALESYEV
1143|gene|hla       VLVRDG-----DLYVIDATSVSEAGRESARSYDLASALAALEPLIGAAAAIDAALDSYST
                    :*:  .      :*.**.* *      .* .**:*.**. :.* :*.  ::  *   :  

586|hp|hut          ETLLTARDFLDFVTIRPDHDFDAAAVKGEIEKVATG-------
4094|hp|nph         AELLAAREFLDFVALRPDHDFDAAALKGELEKRAN--------
1427|gene|hhi       SELLAAEEFLDFVNIRPDHDFAAAEIRGAVEKRA---------
10778|hp|hma        SELLAAEEFLDFVNIRPDHDFAAAEIRGAVEKHA---------
2347|hp|hwa         SELLVAARFLDFVNIRPDHDFDSAVLKGEIETRAASAESNPAI
20450|gene|hbo      DALLDALDFLDFVNIRPDHDFDAAALKGVIEQRAI--------
1143|gene|hla       DEILAARQFLDFVAIRPDHEFDAAALTGELEKRAT--------
                      :* *  ***** :****:* :* : * :*  *